Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4834
Gene name
LocationContig_456:1089..4080
Strand+
Gene length (bp)2991
Transcript length (bp)2415
Coding sequence length (bp)2415
Protein length (aa) 805

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 2.4E-55 25 368
PF10232 Med8 Mediator of RNA polymerase II transcription complex subunit 8 3.1E-35 557 741
PF12411 Choline_sulf_C Choline sulfatase enzyme C terminal 1.9E-25 480 531
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 5.9E-07 29 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O69787|BETC_RHIME Choline-sulfatase OS=Rhizobium meliloti (strain 1021) GN=betC PE=1 SV=2 24 532 6.0E-146
sp|Q7SGQ0|MED8_NEUCR Mediator of RNA polymerase II transcription subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-8 PE=3 SV=1 553 777 5.0E-37
sp|Q2HDD6|MED8_CHAGB Mediator of RNA polymerase II transcription subunit 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MED8 PE=3 SV=1 556 723 4.0E-35
sp|Q148F3|ARSK_BOVIN Arylsulfatase K OS=Bos taurus GN=ARSK PE=2 SV=1 20 492 1.0E-33
sp|Q5ZK90|ARSK_CHICK Arylsulfatase K OS=Gallus gallus GN=ARSK PE=2 SV=1 22 442 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O69787|BETC_RHIME Choline-sulfatase OS=Rhizobium meliloti (strain 1021) GN=betC PE=1 SV=2 24 532 6.0E-146
sp|Q7SGQ0|MED8_NEUCR Mediator of RNA polymerase II transcription subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-8 PE=3 SV=1 553 777 5.0E-37
sp|Q2HDD6|MED8_CHAGB Mediator of RNA polymerase II transcription subunit 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MED8 PE=3 SV=1 556 723 4.0E-35
sp|Q148F3|ARSK_BOVIN Arylsulfatase K OS=Bos taurus GN=ARSK PE=2 SV=1 20 492 1.0E-33
sp|Q5ZK90|ARSK_CHICK Arylsulfatase K OS=Gallus gallus GN=ARSK PE=2 SV=1 22 442 4.0E-33
sp|P31447|YIDJ_ECOLI Uncharacterized sulfatase YidJ OS=Escherichia coli (strain K12) GN=yidJ PE=3 SV=1 24 441 4.0E-33
sp|Q0TUK6|SULF_CLOP1 Arylsulfatase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=CPF_0221 PE=1 SV=1 24 441 6.0E-33
sp|Q8XNV1|SULF_CLOPE Arylsulfatase OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0231 PE=3 SV=1 24 441 2.0E-32
sp|Q08CJ7|ARSK_DANRE Arylsulfatase K OS=Danio rerio GN=arsk PE=2 SV=1 24 442 4.0E-32
sp|Q0IHJ2|ARSK_XENLA Arylsulfatase K OS=Xenopus laevis GN=arsk PE=2 SV=1 19 502 2.0E-31
sp|Q32KJ2|ARSK_RAT Arylsulfatase K OS=Rattus norvegicus GN=Arsk PE=2 SV=1 7 492 8.0E-31
sp|Q9D2L1|ARSK_MOUSE Arylsulfatase K OS=Mus musculus GN=Arsk PE=2 SV=2 25 492 8.0E-31
sp|Q32KH0|ARSK_CANLF Arylsulfatase K OS=Canis lupus familiaris GN=ARSK PE=2 SV=1 25 492 2.0E-29
sp|Q08890|IDS_MOUSE Iduronate 2-sulfatase OS=Mus musculus GN=Ids PE=2 SV=3 26 390 6.0E-26
sp|P22304|IDS_HUMAN Iduronate 2-sulfatase OS=Homo sapiens GN=IDS PE=1 SV=1 26 396 5.0E-25
sp|Q4WP83|MED8_ASPFU Mediator of RNA polymerase II transcription subunit 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med8 PE=3 SV=1 556 723 5.0E-25
sp|A1CXD6|MED8_NEOFI Mediator of RNA polymerase II transcription subunit 8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=med8 PE=3 SV=1 556 723 8.0E-25
sp|Q2UGT1|MED8_ASPOR Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med8 PE=3 SV=1 559 723 1.0E-24
sp|A1CHE9|MED8_ASPCL Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=med8 PE=3 SV=1 559 723 2.0E-23
sp|Q1DLG1|MED8_COCIM Mediator of RNA polymerase II transcription subunit 8 OS=Coccidioides immitis (strain RS) GN=MED8 PE=3 SV=1 556 723 5.0E-23
sp|Q1LZH9|GNS_BOVIN N-acetylglucosamine-6-sulfatase OS=Bos taurus GN=GNS PE=2 SV=1 24 403 2.0E-21
sp|Q8BFR4|GNS_MOUSE N-acetylglucosamine-6-sulfatase OS=Mus musculus GN=Gns PE=1 SV=1 24 403 2.0E-21
sp|Q571E4|GALNS_MOUSE N-acetylgalactosamine-6-sulfatase OS=Mus musculus GN=Galns PE=1 SV=2 25 386 3.0E-21
sp|Q32KJ6|GALNS_RAT N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus GN=Galns PE=1 SV=1 25 386 6.0E-21
sp|P50426|GNS_CAPHI N-acetylglucosamine-6-sulfatase OS=Capra hircus GN=GNS PE=2 SV=1 24 403 9.0E-21
sp|P34059|GALNS_HUMAN N-acetylgalactosamine-6-sulfatase OS=Homo sapiens GN=GALNS PE=1 SV=1 25 386 1.0E-20
sp|Q9VEX0|SULF1_DROME Extracellular sulfatase SULF-1 homolog OS=Drosophila melanogaster GN=Sulf1 PE=1 SV=1 24 388 3.0E-20
sp|P51691|ARS_PSEAE Arylsulfatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atsA PE=1 SV=3 24 442 3.0E-20
sp|Q32KH5|GALNS_CANLF N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris GN=GALNS PE=2 SV=1 25 412 4.0E-20
sp|Q8WNQ7|GALNS_PIG N-acetylgalactosamine-6-sulfatase OS=Sus scrofa GN=GALNS PE=2 SV=1 25 386 5.0E-20
sp|P15586|GNS_HUMAN N-acetylglucosamine-6-sulfatase OS=Homo sapiens GN=GNS PE=1 SV=3 57 403 8.0E-20
sp|Q6UWY0|ARSK_HUMAN Arylsulfatase K OS=Homo sapiens GN=ARSK PE=1 SV=1 265 492 1.0E-19
sp|P50428|ARSA_MOUSE Arylsulfatase A OS=Mus musculus GN=Arsa PE=1 SV=2 23 466 2.0E-19
sp|Q08DD1|ARSA_BOVIN Arylsulfatase A OS=Bos taurus GN=ARSA PE=2 SV=1 23 466 6.0E-19
sp|A2QID5|MED8_ASPNC Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med8 PE=3 SV=1 556 723 7.0E-19
sp|Q5BCL0|MED8_EMENI Mediator of RNA polymerase II transcription subunit 8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med8 PE=3 SV=1 556 664 5.0E-17
sp|Q9C0V7|YHJ2_SCHPO Uncharacterized sulfatase PB10D8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.02c PE=3 SV=1 17 445 1.0E-16
sp|Q90XB6|SULF1_COTCO Extracellular sulfatase Sulf-1 OS=Coturnix coturnix GN=SULF1 PE=1 SV=1 24 385 4.0E-16
sp|Q8K007|SULF1_MOUSE Extracellular sulfatase Sulf-1 OS=Mus musculus GN=Sulf1 PE=2 SV=1 24 382 3.0E-15
sp|Q8IWU6|SULF1_HUMAN Extracellular sulfatase Sulf-1 OS=Homo sapiens GN=SULF1 PE=1 SV=1 24 382 4.0E-15
sp|P50473|ARS_STRPU Arylsulfatase OS=Strongylocentrotus purpuratus PE=2 SV=1 15 417 5.0E-15
sp|Q32KJ9|ARSG_RAT Arylsulfatase G OS=Rattus norvegicus GN=Arsg PE=2 SV=1 24 443 2.0E-14
sp|P50429|ARSB_MOUSE Arylsulfatase B OS=Mus musculus GN=Arsb PE=1 SV=3 25 381 5.0E-14
sp|P77318|YDEN_ECOLI Uncharacterized sulfatase YdeN OS=Escherichia coli (strain K12) GN=ydeN PE=3 SV=2 47 391 6.0E-14
sp|Q9X759|ATSA_KLEPN Arylsulfatase OS=Klebsiella pneumoniae GN=atsA PE=1 SV=1 24 442 1.0E-13
sp|P14000|ARS_HEMPU Arylsulfatase OS=Hemicentrotus pulcherrimus PE=1 SV=1 24 417 2.0E-13
sp|P51688|SPHM_HUMAN N-sulphoglucosamine sulphohydrolase OS=Homo sapiens GN=SGSH PE=1 SV=1 23 389 3.0E-13
sp|Q21376|SULF1_CAEEL Putative extracellular sulfatase Sulf-1 homolog OS=Caenorhabditis elegans GN=sul-1 PE=3 SV=1 57 398 9.0E-13
sp|P50430|ARSB_RAT Arylsulfatase B OS=Rattus norvegicus GN=Arsb PE=2 SV=2 25 381 1.0E-12
sp|P15289|ARSA_HUMAN Arylsulfatase A OS=Homo sapiens GN=ARSA PE=1 SV=3 25 125 2.0E-12
sp|Q96EG1|ARSG_HUMAN Arylsulfatase G OS=Homo sapiens GN=ARSG PE=1 SV=1 22 443 6.0E-12
sp|P08842|STS_HUMAN Steryl-sulfatase OS=Homo sapiens GN=STS PE=1 SV=2 23 131 8.0E-12
sp|Q3TYD4|ARSG_MOUSE Arylsulfatase G OS=Mus musculus GN=Arsg PE=2 SV=1 24 433 1.0E-11
sp|P51690|ARSE_HUMAN Arylsulfatase E OS=Homo sapiens GN=ARSE PE=1 SV=2 3 125 4.0E-11
sp|Q60HH5|ARSE_MACFA Arylsulfatase E OS=Macaca fascicularis GN=ARSE PE=2 SV=1 14 125 1.0E-10
sp|P15589|STS_RAT Steryl-sulfatase OS=Rattus norvegicus GN=Sts PE=1 SV=2 22 159 1.0E-10
sp|P15848|ARSB_HUMAN Arylsulfatase B OS=Homo sapiens GN=ARSB PE=1 SV=1 12 313 1.0E-10
sp|Q32KJ8|ARSI_RAT Arylsulfatase I OS=Rattus norvegicus GN=Arsi PE=2 SV=1 26 383 1.0E-10
sp|Q5FYA8|ARSH_HUMAN Arylsulfatase H OS=Homo sapiens GN=ARSH PE=2 SV=1 23 124 3.0E-10
sp|Q5FYB1|ARSI_HUMAN Arylsulfatase I OS=Homo sapiens GN=ARSI PE=1 SV=1 26 383 4.0E-10
sp|P20713|ATSA_ENTAE Arylsulfatase OS=Enterobacter aerogenes GN=atsA PE=1 SV=1 24 381 7.0E-10
sp|Q32KH8|ARSH_CANLF Arylsulfatase H OS=Canis lupus familiaris GN=ARSH PE=2 SV=1 23 124 8.0E-10
sp|P15289|ARSA_HUMAN Arylsulfatase A OS=Homo sapiens GN=ARSA PE=1 SV=3 271 441 2.0E-09
sp|P50427|STS_MOUSE Steryl-sulfatase OS=Mus musculus GN=Sts PE=1 SV=1 26 125 2.0E-09
sp|P50427|STS_MOUSE Steryl-sulfatase OS=Mus musculus GN=Sts PE=1 SV=1 276 387 6.0E-09
sp|P51689|ARSD_HUMAN Arylsulfatase D OS=Homo sapiens GN=ARSD PE=1 SV=2 18 124 2.0E-08
sp|P54793|ARSF_HUMAN Arylsulfatase F OS=Homo sapiens GN=ARSF PE=1 SV=4 24 160 3.0E-08
sp|Q32KH9|ARSG_CANLF Arylsulfatase G OS=Canis lupus familiaris GN=ARSG PE=2 SV=1 22 125 5.0E-08
sp|Q6BM45|MED8_DEBHA Mediator of RNA polymerase II transcription subunit 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MED8 PE=3 SV=2 542 658 1.0E-07
sp|Q59TD3|MED8_CANAL Mediator of RNA polymerase II transcription subunit 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED8 PE=3 SV=1 542 698 8.0E-07
sp|P15589|STS_RAT Steryl-sulfatase OS=Rattus norvegicus GN=Sts PE=1 SV=2 276 388 2.0E-06
sp|Q6CG02|MED8_YARLI Mediator of RNA polymerase II transcription subunit 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED8 PE=3 SV=1 562 665 3.0E-06
sp|P25549|ASLA_ECOLI Arylsulfatase OS=Escherichia coli (strain K12) GN=aslA PE=3 SV=2 273 410 3.0E-06
sp|P54793|ARSF_HUMAN Arylsulfatase F OS=Homo sapiens GN=ARSF PE=1 SV=4 266 402 9.0E-06
sp|P51689|ARSD_HUMAN Arylsulfatase D OS=Homo sapiens GN=ARSD PE=1 SV=2 266 402 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0003712 transcription coregulator activity Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0031323 regulation of cellular metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0010468 regulation of gene expression No
GO:0140513 nuclear protein-containing complex No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0016787 hydrolase activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4834
MSPDLNSLPVSAPPTGKKGPDGSRPNMLYIMADQLAAPQLAMYNAESQIKTPNLDRLAAASVQFDSAYCPSPLCA
PSRMSMITGLLPMKIGAFDNAAQISSEIPTYAHYLRSRGYHTALAGKMHFVGDQLHGYEQRLTSDIYPADFGWAV
NWDEPETRLEWYHNASSILQAGPCGRSNQLDYDEEVMFRSTQYLWDHVRQGPGKRPFALTVSLTHPHDPYTITRK
YWDLYEDVDIALPKARVPKDELDAHSQRLMRVCDLWDHDLTDDQIKRAKRAYYGSVSYVDDCIGRLLETLRDAGL
ADDTIVIFSGDHGDMLGERGLWYKMSYFESSVRVPLLVHYPRWFSPRRVSQNVSTLDLLPTICDFIGVKPAPLLP
MDGISMLPHLLGREGGHDTVLAEYTGEGTVRPIMMIRRGPWKYITCPADEPQLYNLDDDPLELDNLARLRNQAPQ
NTAQAKAKAIFAEYDAEAKERWDFDAITAQVLQSQRSRRLVWDALKQGAFTSWDFDPVDDGRTKYIRSTIPLDEL
ERRARYPFVDSKAYSFSKTVDSTRRMATLGLDDDELKSVEQLVARLAQLSSSIQSLKMDILKSNPLPHASSLQAS
AQILQRNLQTVLDSLAENADLFGRMALHPATNYPGRTQEGVLTQLLRKKLEPDVEELVVEGREAARLATAEGVAA
LQAIWDELRQWTHDRIATYVRDEAGQVFTAEERAAGTETVRTGLRRALDEESDDEDEEGGDEEDEDAAAAVRARL
ERGPEPETLLWFAARGDFELPRNVEYERKVGVNRGLEGVNIPPEEVVPDATAAA*
Coding >Ophun1|4834
ATGTCTCCCGACCTCAACTCACTGCCAGTCTCAGCGCCCCCAACCGGCAAAAAGGGCCCGGACGGCTCACGCCCC
AACATGCTCTACATCATGGCCGATCAGTTGGCGGCGCCGCAGCTGGCCATGTACAACGCCGAGTCGCAGATCAAG
ACGCCCAACCTCGATCGATTGGCGGCCGCATCCGTGCAGTTCGACTCGGCTTACTGTCCCTCGCCGCTGTGCGCG
CCCTCGCGGATGAGCATGATTACGGGATTGCTGCCCATGAAGATTGGCGCTTTTGATAATGCGGCCCAGATTAGC
TCTGAGATCCCGACGTATGCGCATTACTTGCGCTCGCGTGGCTACCATACCGCTCTTGCTGGGAAGATGCACTTT
GTGGGCGATCAGTTGCATGGTTACGAGCAGCGCCTTACCAGCGACATCTATCCGGCTGACTTTGGATGGGCTGTC
AATTGGGATGAGCCGGAGACTCGGCTTGAGTGGTATCATAATGCCAGCTCTATCCTGCAGGCTGGACCGTGTGGC
CGCAGCAATCAGCTTGACTATGACGAGGAGGTCATGTTCCGCAGCACGCAGTATCTGTGGGATCATGTTCGGCAG
GGGCCTGGGAAGAGGCCTTTTGCTCTGACGGTCTCTCTCACCCACCCGCACGACCCTTATACCATCACGAGAAAG
TACTGGGATCTCTACGAAGATGTCGACATTGCGCTACCCAAGGCTCGCGTCCCCAAGGACGAGCTCGACGCTCAT
AGCCAGCGCCTCATGCGCGTCTGCGACCTGTGGGATCACGACCTTACCGACGACCAGATCAAGAGGGCCAAGCGC
GCATACTACGGCTCCGTCAGCTACGTCGATGACTGCATCGGCCGTCTGCTCGAGACGTTGCGCGACGCCGGTCTG
GCTGACGACACCATTGTCATCTTCAGCGGCGACCATGGCGATATGCTGGGCGAGCGCGGACTCTGGTACAAGATG
AGCTACTTCGAGTCGTCGGTTCGTGTGCCGCTGCTCGTTCACTACCCGCGCTGGTTCTCGCCTCGTCGCGTGTCG
CAGAATGTGTCGACGCTGGACCTGCTGCCGACCATCTGCGACTTCATCGGCGTCAAGCCTGCGCCTCTTTTGCCA
ATGGATGGCATCAGCATGCTGCCTCATCTTCTGGGCCGCGAGGGCGGGCACGACACCGTCCTGGCCGAGTACACG
GGCGAGGGCACCGTCCGGCCCATCATGATGATCCGCCGTGGGCCTTGGAAGTACATCACCTGTCCGGCCGACGAG
CCGCAGCTGTACAACCTCGACGATGACCCGCTCGAGCTGGATAACCTGGCTCGTCTGCGCAACCAGGCGCCCCAG
AACACCGCGCAGGCCAAGGCAAAGGCCATCTTTGCAGAGTATGATGCTGAGGCCAAGGAGCGGTGGGACTTTGAC
GCCATTACCGCTCAGGTGCTGCAGTCGCAGCGTAGCCGTCGGCTGGTGTGGGATGCGCTGAAGCAGGGTGCCTTT
ACGAGTTGGGACTTTGACCCTGTCGACGATGGCCGGACAAAATACATTCGCTCCACTATACCTCTTGACGAACTC
GAGCGTCGCGCGCGCTACCCGTTTGTCGACTCCAAGGCGTACTCGTTCTCCAAGACGGTCGACTCGACCCGCCGT
ATGGCGACGCTGGGTCTCGACGATGACGAGCTCAAGTCGGTGGAGCAGCTCGTCGCCCGTCTGGCGCAGCTCTCC
AGCAGCATCCAGAGCCTGAAGATGGACATACTCAAAAGCAACCCGCTGCCTCACGCCTCATCCCTCCAAGCGTCT
GCGCAAATCCTCCAGCGCAACCTTCAGACCGTGCTAGACAGCCTCGCCGAAAACGCCGACCTCTTTGGCCGCATG
GCCCTCCACCCGGCGACCAACTATCCCGGCCGCACGCAGGAAGGTGTGCTAACGCAGCTGCTGCGCAAGAAGCTC
GAGCCGGATGTCGAGGAGCTGGTCGTCGAGGGGCGGGAGGCGGCACGGCTTGCTACGGCCGAGGGTGTCGCTGCG
CTGCAGGCTATATGGGATGAGCTGCGGCAGTGGACGCATGATAGGATTGCTACGTATGTTCGTGACGAGGCGGGG
CAGGTGTTTACGGCCGAGGAGCGGGCTGCGGGGACGGAAACGGTGCGCACCGGCTTGAGGCGGGCGCTTGATGAG
GAGAGTGATGATGAGGATGAGGAGGGGGGGGACGAGGAGGATGAGGATGCTGCTGCTGCGGTGAGGGCGCGGCTC
GAGAGGGGACCCGAGCCTGAGACGTTGCTTTGGTTCGCTGCTCGTGGCGACTTTGAACTGCCGAGGAACGTCGAG
TACGAGAGAAAGGTGGGCGTCAACAGGGGCCTTGAGGGTGTCAACATCCCACCTGAGGAGGTGGTGCCCGATGCA
ACAGCCGCGGCTTAG
Transcript >Ophun1|4834
ATGTCTCCCGACCTCAACTCACTGCCAGTCTCAGCGCCCCCAACCGGCAAAAAGGGCCCGGACGGCTCACGCCCC
AACATGCTCTACATCATGGCCGATCAGTTGGCGGCGCCGCAGCTGGCCATGTACAACGCCGAGTCGCAGATCAAG
ACGCCCAACCTCGATCGATTGGCGGCCGCATCCGTGCAGTTCGACTCGGCTTACTGTCCCTCGCCGCTGTGCGCG
CCCTCGCGGATGAGCATGATTACGGGATTGCTGCCCATGAAGATTGGCGCTTTTGATAATGCGGCCCAGATTAGC
TCTGAGATCCCGACGTATGCGCATTACTTGCGCTCGCGTGGCTACCATACCGCTCTTGCTGGGAAGATGCACTTT
GTGGGCGATCAGTTGCATGGTTACGAGCAGCGCCTTACCAGCGACATCTATCCGGCTGACTTTGGATGGGCTGTC
AATTGGGATGAGCCGGAGACTCGGCTTGAGTGGTATCATAATGCCAGCTCTATCCTGCAGGCTGGACCGTGTGGC
CGCAGCAATCAGCTTGACTATGACGAGGAGGTCATGTTCCGCAGCACGCAGTATCTGTGGGATCATGTTCGGCAG
GGGCCTGGGAAGAGGCCTTTTGCTCTGACGGTCTCTCTCACCCACCCGCACGACCCTTATACCATCACGAGAAAG
TACTGGGATCTCTACGAAGATGTCGACATTGCGCTACCCAAGGCTCGCGTCCCCAAGGACGAGCTCGACGCTCAT
AGCCAGCGCCTCATGCGCGTCTGCGACCTGTGGGATCACGACCTTACCGACGACCAGATCAAGAGGGCCAAGCGC
GCATACTACGGCTCCGTCAGCTACGTCGATGACTGCATCGGCCGTCTGCTCGAGACGTTGCGCGACGCCGGTCTG
GCTGACGACACCATTGTCATCTTCAGCGGCGACCATGGCGATATGCTGGGCGAGCGCGGACTCTGGTACAAGATG
AGCTACTTCGAGTCGTCGGTTCGTGTGCCGCTGCTCGTTCACTACCCGCGCTGGTTCTCGCCTCGTCGCGTGTCG
CAGAATGTGTCGACGCTGGACCTGCTGCCGACCATCTGCGACTTCATCGGCGTCAAGCCTGCGCCTCTTTTGCCA
ATGGATGGCATCAGCATGCTGCCTCATCTTCTGGGCCGCGAGGGCGGGCACGACACCGTCCTGGCCGAGTACACG
GGCGAGGGCACCGTCCGGCCCATCATGATGATCCGCCGTGGGCCTTGGAAGTACATCACCTGTCCGGCCGACGAG
CCGCAGCTGTACAACCTCGACGATGACCCGCTCGAGCTGGATAACCTGGCTCGTCTGCGCAACCAGGCGCCCCAG
AACACCGCGCAGGCCAAGGCAAAGGCCATCTTTGCAGAGTATGATGCTGAGGCCAAGGAGCGGTGGGACTTTGAC
GCCATTACCGCTCAGGTGCTGCAGTCGCAGCGTAGCCGTCGGCTGGTGTGGGATGCGCTGAAGCAGGGTGCCTTT
ACGAGTTGGGACTTTGACCCTGTCGACGATGGCCGGACAAAATACATTCGCTCCACTATACCTCTTGACGAACTC
GAGCGTCGCGCGCGCTACCCGTTTGTCGACTCCAAGGCGTACTCGTTCTCCAAGACGGTCGACTCGACCCGCCGT
ATGGCGACGCTGGGTCTCGACGATGACGAGCTCAAGTCGGTGGAGCAGCTCGTCGCCCGTCTGGCGCAGCTCTCC
AGCAGCATCCAGAGCCTGAAGATGGACATACTCAAAAGCAACCCGCTGCCTCACGCCTCATCCCTCCAAGCGTCT
GCGCAAATCCTCCAGCGCAACCTTCAGACCGTGCTAGACAGCCTCGCCGAAAACGCCGACCTCTTTGGCCGCATG
GCCCTCCACCCGGCGACCAACTATCCCGGCCGCACGCAGGAAGGTGTGCTAACGCAGCTGCTGCGCAAGAAGCTC
GAGCCGGATGTCGAGGAGCTGGTCGTCGAGGGGCGGGAGGCGGCACGGCTTGCTACGGCCGAGGGTGTCGCTGCG
CTGCAGGCTATATGGGATGAGCTGCGGCAGTGGACGCATGATAGGATTGCTACGTATGTTCGTGACGAGGCGGGG
CAGGTGTTTACGGCCGAGGAGCGGGCTGCGGGGACGGAAACGGTGCGCACCGGCTTGAGGCGGGCGCTTGATGAG
GAGAGTGATGATGAGGATGAGGAGGGGGGGGACGAGGAGGATGAGGATGCTGCTGCTGCGGTGAGGGCGCGGCTC
GAGAGGGGACCCGAGCCTGAGACGTTGCTTTGGTTCGCTGCTCGTGGCGACTTTGAACTGCCGAGGAACGTCGAG
TACGAGAGAAAGGTGGGCGTCAACAGGGGCCTTGAGGGTGTCAACATCCCACCTGAGGAGGTGGTGCCCGATGCA
ACAGCCGCGGCTTAG
Gene >Ophun1|4834
ATGTCTCCCGACCTCAACTCACTGCCAGTCTCAGCGCCCCCAACCGGCAAAAAGGGCCCGGACGGCTCACGCCCC
AACATGCTCTACATCATGGCCGATCAGTTGGCGGCGCCGCAGCTGGCCATGTACAACGCCGAGTCGCAGATCAAG
ACGCCCAACCTCGATCGATTGGCGGCCGCATCCGTGCAGTTCGACTCGGCTTACTGTCCCTCGCCGCTGTGCGCG
CCCTCGCGGATGAGCATGATTACGGGATTGCTGCCCATGAAGATTGGCGCTTTTGATAATGCGGCCCAGATTAGC
TCTGAGATCCCGACGTATGCGCATTACTTGCGCTCGCGTGGCTACCATACCGCTCTTGCTGGGAAGATGCACTTT
GTGGGCGATCAGTTGCATGGTTACGAGCAGCGCCTTACCAGCGACATCTATCCGGCTGACTTTGGATGGGCTGTC
AATTGGGATGAGCCGGAGACTCGGCTTGAGTGGTATCATAATGCCAGCTCTATCCTGCAGGCTGGACCGTGTGGC
CGCAGCAATCAGCTTGACTATGACGAGGAGGTCATGTTCCGCAGCACGCAGTATCTGTGGGATCATGTTCGGCAG
GGGCCTGGGAAGAGGCCTTTTGCTCTGACGGTATGTTGCAGTTGATCAAGGCTGGGGGTTTTGAGGCTGATGGTC
GGGATAGGTCTCTCTCACCCACCCGCACGACCCTTATACCATCACGAGAAAGTACTGGGATCTCTACGAAGATGT
CGACATTGCGCTACCCAAGGCTCGCGTCCCCAAGGACGAGCTCGACGCTCATAGCCAGCGCCTCATGCGCGTCTG
CGACCTGTGGGATCACGACCTTACCGACGACCAGATCAAGAGGGCCAAGCGCGCATACTACGGCTCCGTCAGCTA
CGTCGATGACTGCATCGGCCGTCTGCTCGAGACGTTGCGCGACGCCGGTCTGGCTGACGACACCATTGTCATCTT
CAGCGGCGACCATGGCGATATGCTGGGCGAGCGCGGACTCTGGTACAAGATGAGCTACTTCGAGTCGTCGGTTCG
TGTGCCGCTGCTCGTTCACTACCCGCGCTGGTTCTCGCCTCGTCGCGTGTCGCAGAATGTGTCGACGCTGGACCT
GCTGCCGACCATCTGCGACTTCATCGGCGTCAAGCCTGCGCCTCTTTTGCCAATGGATGGCATCAGCATGCTGCC
TCATCTTCTGGGCCGCGAGGGCGGGCACGACACCGTCCTGGCCGAGTACACGGGCGAGGGCACCGTCCGGCCCAT
CATGATGATCCGCCGTGGGCCTTGGAAGTACATCACCTGTCCGGCCGACGAGCCGCAGCTGTACAACCTCGACGA
TGACCCGCTCGAGCTGGATAACCTGGCTCGTCTGCGCAACCAGGCGCCCCAGAACACCGCGCAGGCCAAGGCAAA
GGCCATCTTTGCAGAGTATGATGCTGAGGCCAAGGAGCGGTGGGACTTTGACGCCATTACCGCTCAGGTGCTGCA
GTCGCAGCGTAGCCGTCGGCTGGTGTGGGATGCGCTGAAGCAGGGTGCCTTTACGAGTTGGGACTTTGACCCTGT
CGACGATGGCCGGACAAAGTGAGCAGCTCCCCCATGCCGACTCTTTCGTGATGCAGTGCTGACCAGGACGATTTC
AAGATACATTCGCTCCACTATACCTCTTGACGAACTCGAGCGTCGCGCGCGCTACCCGTTTGTCGACTCCAAGGC
GTACTCGTTCTCCAAGACGGTCGACTCGACCCGCCGGTAAGGGAAGGCGTGTATCGACAGGTTGAACGAGGCAGC
ATCAGGCGAAGCTGCTGCTGCTGCGCATTAGGAGGCGTGACTCCGAAGAGGATGAAAGGGGGAAAAGAGTGGGAC
ATGAGGATCGGTGTTTGGTTGCTTTTTTTCCGCTTGGCTGTCGTTGGGTTGAGGCTCTGCGCATGAAGTCGCTGG
TGGAGCCTGTGGAGTTGTGGAGTCGGGACGGGGCTTAGGGCTGTGGATACTTGGATTGACGCACAGAATGTATGG
CTGCGTTTGTACCTGTTATGTACCGTTTCTTATCACGCACCATCGTCATCATCCTCTTTCTGCGCCCATTTCTCA
GACTTCCAAGTGCCTCGGCCTCTACGACTCTCGCATAGCATCGACCTACGAGTTTAGTTCACTAGTATGGCGACG
CTGGGTCTCGACGATGACGAGCTCAAGTCGGTGGAGCAGCTCGTCGCCCGTCTGGCGCAGCTCTCCAGCAGCATC
CAGAGCCTGAAGATGGACATACTCAAAAGCAACCCGCTGCCTCACGCGTTTGTTTCCCAATCATGCTGTGACGAG
TATCAACTGACACCTCAAACGCATCCTTGCAGCTCATCCCTCCAAGCGTCTGCGCAAATCCTCCAGCGCAACCTT
CAGACCGTGCTAGACAGCCTCGCCGAAAACGCCGACCTCTTTGGCCGCATGGCCCTCCACCCGGCGACCAACTAT
CCCGGCCGCACGCAGGAAGGTGTGCTAACGCAGCTGCTGCGCAAGAAGCTCGAGCCGGATGTCGAGGAGCTGGTC
GTCGAGGGGCGGGAGGCGGCACGGCTTGCTACGGCCGAGGGTGTCGCTGCGCTGCAGGCTATATGGGATGAGCTG
CGGCAGTGGACGCATGATAGGATTGCTACGTATGTTCGTGACGAGGCGGGGCAGGTGTTTACGGCCGAGGAGCGG
GCTGCGGGGACGGAAACGGTGCGCACCGGCTTGAGGCGGGCGCTTGATGAGGAGAGTGATGATGAGGATGAGGAG
GGGGGGGACGAGGAGGATGAGGATGCTGCTGCTGCGGTGAGGGCGCGGCTCGAGAGGGGACCCGAGCCTGAGACG
TTGCTTTGGTTCGCTGCTCGTGGCGACTTTGAACTGCCGAGGAACGTCGAGTACGAGAGAAAGGTGGGCGTCAAC
AGGGGCCTTGAGGGTGTCAACATCCCACCTGAGGAGGTGGTGCCCGATGCAACAGCCGCGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail