Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4834
Gene name
LocationContig_456:1089..4080
Strand+
Gene length (bp)2991
Transcript length (bp)2415
Coding sequence length (bp)2415
Protein length (aa) 805

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 2.4E-55 25 368
PF10232 Med8 Mediator of RNA polymerase II transcription complex subunit 8 3.1E-35 557 741
PF12411 Choline_sulf_C Choline sulfatase enzyme C terminal 1.9E-25 480 531
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 5.9E-07 29 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O69787|BETC_RHIME Choline-sulfatase OS=Rhizobium meliloti (strain 1021) GN=betC PE=1 SV=2 24 532 6.0E-146
sp|Q7SGQ0|MED8_NEUCR Mediator of RNA polymerase II transcription subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-8 PE=3 SV=1 553 777 5.0E-37
sp|Q2HDD6|MED8_CHAGB Mediator of RNA polymerase II transcription subunit 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MED8 PE=3 SV=1 556 723 4.0E-35
sp|Q148F3|ARSK_BOVIN Arylsulfatase K OS=Bos taurus GN=ARSK PE=2 SV=1 20 492 1.0E-33
sp|Q5ZK90|ARSK_CHICK Arylsulfatase K OS=Gallus gallus GN=ARSK PE=2 SV=1 22 442 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O69787|BETC_RHIME Choline-sulfatase OS=Rhizobium meliloti (strain 1021) GN=betC PE=1 SV=2 24 532 6.0E-146
sp|Q7SGQ0|MED8_NEUCR Mediator of RNA polymerase II transcription subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-8 PE=3 SV=1 553 777 5.0E-37
sp|Q2HDD6|MED8_CHAGB Mediator of RNA polymerase II transcription subunit 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MED8 PE=3 SV=1 556 723 4.0E-35
sp|Q148F3|ARSK_BOVIN Arylsulfatase K OS=Bos taurus GN=ARSK PE=2 SV=1 20 492 1.0E-33
sp|Q5ZK90|ARSK_CHICK Arylsulfatase K OS=Gallus gallus GN=ARSK PE=2 SV=1 22 442 4.0E-33
sp|P31447|YIDJ_ECOLI Uncharacterized sulfatase YidJ OS=Escherichia coli (strain K12) GN=yidJ PE=3 SV=1 24 441 4.0E-33
sp|Q0TUK6|SULF_CLOP1 Arylsulfatase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=CPF_0221 PE=1 SV=1 24 441 6.0E-33
sp|Q8XNV1|SULF_CLOPE Arylsulfatase OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0231 PE=3 SV=1 24 441 2.0E-32
sp|Q08CJ7|ARSK_DANRE Arylsulfatase K OS=Danio rerio GN=arsk PE=2 SV=1 24 442 4.0E-32
sp|Q0IHJ2|ARSK_XENLA Arylsulfatase K OS=Xenopus laevis GN=arsk PE=2 SV=1 19 502 2.0E-31
sp|Q32KJ2|ARSK_RAT Arylsulfatase K OS=Rattus norvegicus GN=Arsk PE=2 SV=1 7 492 8.0E-31
sp|Q9D2L1|ARSK_MOUSE Arylsulfatase K OS=Mus musculus GN=Arsk PE=2 SV=2 25 492 8.0E-31
sp|Q32KH0|ARSK_CANLF Arylsulfatase K OS=Canis lupus familiaris GN=ARSK PE=2 SV=1 25 492 2.0E-29
sp|Q08890|IDS_MOUSE Iduronate 2-sulfatase OS=Mus musculus GN=Ids PE=2 SV=3 26 390 6.0E-26
sp|P22304|IDS_HUMAN Iduronate 2-sulfatase OS=Homo sapiens GN=IDS PE=1 SV=1 26 396 5.0E-25
sp|Q4WP83|MED8_ASPFU Mediator of RNA polymerase II transcription subunit 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med8 PE=3 SV=1 556 723 5.0E-25
sp|A1CXD6|MED8_NEOFI Mediator of RNA polymerase II transcription subunit 8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=med8 PE=3 SV=1 556 723 8.0E-25
sp|Q2UGT1|MED8_ASPOR Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med8 PE=3 SV=1 559 723 1.0E-24
sp|A1CHE9|MED8_ASPCL Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=med8 PE=3 SV=1 559 723 2.0E-23
sp|Q1DLG1|MED8_COCIM Mediator of RNA polymerase II transcription subunit 8 OS=Coccidioides immitis (strain RS) GN=MED8 PE=3 SV=1 556 723 5.0E-23
sp|Q1LZH9|GNS_BOVIN N-acetylglucosamine-6-sulfatase OS=Bos taurus GN=GNS PE=2 SV=1 24 403 2.0E-21
sp|Q8BFR4|GNS_MOUSE N-acetylglucosamine-6-sulfatase OS=Mus musculus GN=Gns PE=1 SV=1 24 403 2.0E-21
sp|Q571E4|GALNS_MOUSE N-acetylgalactosamine-6-sulfatase OS=Mus musculus GN=Galns PE=1 SV=2 25 386 3.0E-21
sp|Q32KJ6|GALNS_RAT N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus GN=Galns PE=1 SV=1 25 386 6.0E-21
sp|P50426|GNS_CAPHI N-acetylglucosamine-6-sulfatase OS=Capra hircus GN=GNS PE=2 SV=1 24 403 9.0E-21
sp|P34059|GALNS_HUMAN N-acetylgalactosamine-6-sulfatase OS=Homo sapiens GN=GALNS PE=1 SV=1 25 386 1.0E-20
sp|Q9VEX0|SULF1_DROME Extracellular sulfatase SULF-1 homolog OS=Drosophila melanogaster GN=Sulf1 PE=1 SV=1 24 388 3.0E-20
sp|P51691|ARS_PSEAE Arylsulfatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atsA PE=1 SV=3 24 442 3.0E-20
sp|Q32KH5|GALNS_CANLF N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris GN=GALNS PE=2 SV=1 25 412 4.0E-20
sp|Q8WNQ7|GALNS_PIG N-acetylgalactosamine-6-sulfatase OS=Sus scrofa GN=GALNS PE=2 SV=1 25 386 5.0E-20
sp|P15586|GNS_HUMAN N-acetylglucosamine-6-sulfatase OS=Homo sapiens GN=GNS PE=1 SV=3 57 403 8.0E-20
sp|Q6UWY0|ARSK_HUMAN Arylsulfatase K OS=Homo sapiens GN=ARSK PE=1 SV=1 265 492 1.0E-19
sp|P50428|ARSA_MOUSE Arylsulfatase A OS=Mus musculus GN=Arsa PE=1 SV=2 23 466 2.0E-19
sp|Q08DD1|ARSA_BOVIN Arylsulfatase A OS=Bos taurus GN=ARSA PE=2 SV=1 23 466 6.0E-19
sp|A2QID5|MED8_ASPNC Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med8 PE=3 SV=1 556 723 7.0E-19
sp|Q5BCL0|MED8_EMENI Mediator of RNA polymerase II transcription subunit 8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med8 PE=3 SV=1 556 664 5.0E-17
sp|Q9C0V7|YHJ2_SCHPO Uncharacterized sulfatase PB10D8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.02c PE=3 SV=1 17 445 1.0E-16
sp|Q90XB6|SULF1_COTCO Extracellular sulfatase Sulf-1 OS=Coturnix coturnix GN=SULF1 PE=1 SV=1 24 385 4.0E-16
sp|Q8K007|SULF1_MOUSE Extracellular sulfatase Sulf-1 OS=Mus musculus GN=Sulf1 PE=2 SV=1 24 382 3.0E-15
sp|Q8IWU6|SULF1_HUMAN Extracellular sulfatase Sulf-1 OS=Homo sapiens GN=SULF1 PE=1 SV=1 24 382 4.0E-15
sp|P50473|ARS_STRPU Arylsulfatase OS=Strongylocentrotus purpuratus PE=2 SV=1 15 417 5.0E-15
sp|Q32KJ9|ARSG_RAT Arylsulfatase G OS=Rattus norvegicus GN=Arsg PE=2 SV=1 24 443 2.0E-14
sp|P50429|ARSB_MOUSE Arylsulfatase B OS=Mus musculus GN=Arsb PE=1 SV=3 25 381 5.0E-14
sp|P77318|YDEN_ECOLI Uncharacterized sulfatase YdeN OS=Escherichia coli (strain K12) GN=ydeN PE=3 SV=2 47 391 6.0E-14
sp|Q9X759|ATSA_KLEPN Arylsulfatase OS=Klebsiella pneumoniae GN=atsA PE=1 SV=1 24 442 1.0E-13
sp|P14000|ARS_HEMPU Arylsulfatase OS=Hemicentrotus pulcherrimus PE=1 SV=1 24 417 2.0E-13
sp|P51688|SPHM_HUMAN N-sulphoglucosamine sulphohydrolase OS=Homo sapiens GN=SGSH PE=1 SV=1 23 389 3.0E-13
sp|Q21376|SULF1_CAEEL Putative extracellular sulfatase Sulf-1 homolog OS=Caenorhabditis elegans GN=sul-1 PE=3 SV=1 57 398 9.0E-13
sp|P50430|ARSB_RAT Arylsulfatase B OS=Rattus norvegicus GN=Arsb PE=2 SV=2 25 381 1.0E-12
sp|P15289|ARSA_HUMAN Arylsulfatase A OS=Homo sapiens GN=ARSA PE=1 SV=3 25 125 2.0E-12
sp|Q96EG1|ARSG_HUMAN Arylsulfatase G OS=Homo sapiens GN=ARSG PE=1 SV=1 22 443 6.0E-12
sp|P08842|STS_HUMAN Steryl-sulfatase OS=Homo sapiens GN=STS PE=1 SV=2 23 131 8.0E-12
sp|Q3TYD4|ARSG_MOUSE Arylsulfatase G OS=Mus musculus GN=Arsg PE=2 SV=1 24 433 1.0E-11
sp|P51690|ARSE_HUMAN Arylsulfatase E OS=Homo sapiens GN=ARSE PE=1 SV=2 3 125 4.0E-11
sp|Q60HH5|ARSE_MACFA Arylsulfatase E OS=Macaca fascicularis GN=ARSE PE=2 SV=1 14 125 1.0E-10
sp|P15589|STS_RAT Steryl-sulfatase OS=Rattus norvegicus GN=Sts PE=1 SV=2 22 159 1.0E-10
sp|P15848|ARSB_HUMAN Arylsulfatase B OS=Homo sapiens GN=ARSB PE=1 SV=1 12 313 1.0E-10
sp|Q32KJ8|ARSI_RAT Arylsulfatase I OS=Rattus norvegicus GN=Arsi PE=2 SV=1 26 383 1.0E-10
sp|Q5FYA8|ARSH_HUMAN Arylsulfatase H OS=Homo sapiens GN=ARSH PE=2 SV=1 23 124 3.0E-10
sp|Q5FYB1|ARSI_HUMAN Arylsulfatase I OS=Homo sapiens GN=ARSI PE=1 SV=1 26 383 4.0E-10
sp|P20713|ATSA_ENTAE Arylsulfatase OS=Enterobacter aerogenes GN=atsA PE=1 SV=1 24 381 7.0E-10
sp|Q32KH8|ARSH_CANLF Arylsulfatase H OS=Canis lupus familiaris GN=ARSH PE=2 SV=1 23 124 8.0E-10
sp|P15289|ARSA_HUMAN Arylsulfatase A OS=Homo sapiens GN=ARSA PE=1 SV=3 271 441 2.0E-09
sp|P50427|STS_MOUSE Steryl-sulfatase OS=Mus musculus GN=Sts PE=1 SV=1 26 125 2.0E-09
sp|P50427|STS_MOUSE Steryl-sulfatase OS=Mus musculus GN=Sts PE=1 SV=1 276 387 6.0E-09
sp|P51689|ARSD_HUMAN Arylsulfatase D OS=Homo sapiens GN=ARSD PE=1 SV=2 18 124 2.0E-08
sp|P54793|ARSF_HUMAN Arylsulfatase F OS=Homo sapiens GN=ARSF PE=1 SV=4 24 160 3.0E-08
sp|Q32KH9|ARSG_CANLF Arylsulfatase G OS=Canis lupus familiaris GN=ARSG PE=2 SV=1 22 125 5.0E-08
sp|Q6BM45|MED8_DEBHA Mediator of RNA polymerase II transcription subunit 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MED8 PE=3 SV=2 542 658 1.0E-07
sp|Q59TD3|MED8_CANAL Mediator of RNA polymerase II transcription subunit 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED8 PE=3 SV=1 542 698 8.0E-07
sp|P15589|STS_RAT Steryl-sulfatase OS=Rattus norvegicus GN=Sts PE=1 SV=2 276 388 2.0E-06
sp|Q6CG02|MED8_YARLI Mediator of RNA polymerase II transcription subunit 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED8 PE=3 SV=1 562 665 3.0E-06
sp|P25549|ASLA_ECOLI Arylsulfatase OS=Escherichia coli (strain K12) GN=aslA PE=3 SV=2 273 410 3.0E-06
sp|P54793|ARSF_HUMAN Arylsulfatase F OS=Homo sapiens GN=ARSF PE=1 SV=4 266 402 9.0E-06
sp|P51689|ARSD_HUMAN Arylsulfatase D OS=Homo sapiens GN=ARSD PE=1 SV=2 266 402 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0003712 transcription coregulator activity Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0031323 regulation of cellular metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0010468 regulation of gene expression No
GO:0140513 nuclear protein-containing complex No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0016787 hydrolase activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2433
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4682
Ophiocordyceps australis map64 (Brazil) OphauB2|4494
Ophiocordyceps camponoti-floridani Ophcf2|03311
Ophiocordyceps camponoti-rufipedis Ophun1|4834 (this protein)
Ophiocordyceps kimflemingae Ophio5|3525
Ophiocordyceps subramaniannii Hirsu2|3454

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4834
MSPDLNSLPVSAPPTGKKGPDGSRPNMLYIMADQLAAPQLAMYNAESQIKTPNLDRLAAASVQFDSAYCPSPLCA
PSRMSMITGLLPMKIGAFDNAAQISSEIPTYAHYLRSRGYHTALAGKMHFVGDQLHGYEQRLTSDIYPADFGWAV
NWDEPETRLEWYHNASSILQAGPCGRSNQLDYDEEVMFRSTQYLWDHVRQGPGKRPFALTVSLTHPHDPYTITRK
YWDLYEDVDIALPKARVPKDELDAHSQRLMRVCDLWDHDLTDDQIKRAKRAYYGSVSYVDDCIGRLLETLRDAGL
ADDTIVIFSGDHGDMLGERGLWYKMSYFESSVRVPLLVHYPRWFSPRRVSQNVSTLDLLPTICDFIGVKPAPLLP
MDGISMLPHLLGREGGHDTVLAEYTGEGTVRPIMMIRRGPWKYITCPADEPQLYNLDDDPLELDNLARLRNQAPQ
NTAQAKAKAIFAEYDAEAKERWDFDAITAQVLQSQRSRRLVWDALKQGAFTSWDFDPVDDGRTKYIRSTIPLDEL
ERRARYPFVDSKAYSFSKTVDSTRRMATLGLDDDELKSVEQLVARLAQLSSSIQSLKMDILKSNPLPHASSLQAS
AQILQRNLQTVLDSLAENADLFGRMALHPATNYPGRTQEGVLTQLLRKKLEPDVEELVVEGREAARLATAEGVAA
LQAIWDELRQWTHDRIATYVRDEAGQVFTAEERAAGTETVRTGLRRALDEESDDEDEEGGDEEDEDAAAAVRARL
ERGPEPETLLWFAARGDFELPRNVEYERKVGVNRGLEGVNIPPEEVVPDATAAA*
Coding >Ophun1|4834
ATGTCTCCCGACCTCAACTCACTGCCAGTCTCAGCGCCCCCAACCGGCAAAAAGGGCCCGGACGGCTCACGCCCC
AACATGCTCTACATCATGGCCGATCAGTTGGCGGCGCCGCAGCTGGCCATGTACAACGCCGAGTCGCAGATCAAG
ACGCCCAACCTCGATCGATTGGCGGCCGCATCCGTGCAGTTCGACTCGGCTTACTGTCCCTCGCCGCTGTGCGCG
CCCTCGCGGATGAGCATGATTACGGGATTGCTGCCCATGAAGATTGGCGCTTTTGATAATGCGGCCCAGATTAGC
TCTGAGATCCCGACGTATGCGCATTACTTGCGCTCGCGTGGCTACCATACCGCTCTTGCTGGGAAGATGCACTTT
GTGGGCGATCAGTTGCATGGTTACGAGCAGCGCCTTACCAGCGACATCTATCCGGCTGACTTTGGATGGGCTGTC
AATTGGGATGAGCCGGAGACTCGGCTTGAGTGGTATCATAATGCCAGCTCTATCCTGCAGGCTGGACCGTGTGGC
CGCAGCAATCAGCTTGACTATGACGAGGAGGTCATGTTCCGCAGCACGCAGTATCTGTGGGATCATGTTCGGCAG
GGGCCTGGGAAGAGGCCTTTTGCTCTGACGGTCTCTCTCACCCACCCGCACGACCCTTATACCATCACGAGAAAG
TACTGGGATCTCTACGAAGATGTCGACATTGCGCTACCCAAGGCTCGCGTCCCCAAGGACGAGCTCGACGCTCAT
AGCCAGCGCCTCATGCGCGTCTGCGACCTGTGGGATCACGACCTTACCGACGACCAGATCAAGAGGGCCAAGCGC
GCATACTACGGCTCCGTCAGCTACGTCGATGACTGCATCGGCCGTCTGCTCGAGACGTTGCGCGACGCCGGTCTG
GCTGACGACACCATTGTCATCTTCAGCGGCGACCATGGCGATATGCTGGGCGAGCGCGGACTCTGGTACAAGATG
AGCTACTTCGAGTCGTCGGTTCGTGTGCCGCTGCTCGTTCACTACCCGCGCTGGTTCTCGCCTCGTCGCGTGTCG
CAGAATGTGTCGACGCTGGACCTGCTGCCGACCATCTGCGACTTCATCGGCGTCAAGCCTGCGCCTCTTTTGCCA
ATGGATGGCATCAGCATGCTGCCTCATCTTCTGGGCCGCGAGGGCGGGCACGACACCGTCCTGGCCGAGTACACG
GGCGAGGGCACCGTCCGGCCCATCATGATGATCCGCCGTGGGCCTTGGAAGTACATCACCTGTCCGGCCGACGAG
CCGCAGCTGTACAACCTCGACGATGACCCGCTCGAGCTGGATAACCTGGCTCGTCTGCGCAACCAGGCGCCCCAG
AACACCGCGCAGGCCAAGGCAAAGGCCATCTTTGCAGAGTATGATGCTGAGGCCAAGGAGCGGTGGGACTTTGAC
GCCATTACCGCTCAGGTGCTGCAGTCGCAGCGTAGCCGTCGGCTGGTGTGGGATGCGCTGAAGCAGGGTGCCTTT
ACGAGTTGGGACTTTGACCCTGTCGACGATGGCCGGACAAAATACATTCGCTCCACTATACCTCTTGACGAACTC
GAGCGTCGCGCGCGCTACCCGTTTGTCGACTCCAAGGCGTACTCGTTCTCCAAGACGGTCGACTCGACCCGCCGT
ATGGCGACGCTGGGTCTCGACGATGACGAGCTCAAGTCGGTGGAGCAGCTCGTCGCCCGTCTGGCGCAGCTCTCC
AGCAGCATCCAGAGCCTGAAGATGGACATACTCAAAAGCAACCCGCTGCCTCACGCCTCATCCCTCCAAGCGTCT
GCGCAAATCCTCCAGCGCAACCTTCAGACCGTGCTAGACAGCCTCGCCGAAAACGCCGACCTCTTTGGCCGCATG
GCCCTCCACCCGGCGACCAACTATCCCGGCCGCACGCAGGAAGGTGTGCTAACGCAGCTGCTGCGCAAGAAGCTC
GAGCCGGATGTCGAGGAGCTGGTCGTCGAGGGGCGGGAGGCGGCACGGCTTGCTACGGCCGAGGGTGTCGCTGCG
CTGCAGGCTATATGGGATGAGCTGCGGCAGTGGACGCATGATAGGATTGCTACGTATGTTCGTGACGAGGCGGGG
CAGGTGTTTACGGCCGAGGAGCGGGCTGCGGGGACGGAAACGGTGCGCACCGGCTTGAGGCGGGCGCTTGATGAG
GAGAGTGATGATGAGGATGAGGAGGGGGGGGACGAGGAGGATGAGGATGCTGCTGCTGCGGTGAGGGCGCGGCTC
GAGAGGGGACCCGAGCCTGAGACGTTGCTTTGGTTCGCTGCTCGTGGCGACTTTGAACTGCCGAGGAACGTCGAG
TACGAGAGAAAGGTGGGCGTCAACAGGGGCCTTGAGGGTGTCAACATCCCACCTGAGGAGGTGGTGCCCGATGCA
ACAGCCGCGGCTTAG
Transcript >Ophun1|4834
ATGTCTCCCGACCTCAACTCACTGCCAGTCTCAGCGCCCCCAACCGGCAAAAAGGGCCCGGACGGCTCACGCCCC
AACATGCTCTACATCATGGCCGATCAGTTGGCGGCGCCGCAGCTGGCCATGTACAACGCCGAGTCGCAGATCAAG
ACGCCCAACCTCGATCGATTGGCGGCCGCATCCGTGCAGTTCGACTCGGCTTACTGTCCCTCGCCGCTGTGCGCG
CCCTCGCGGATGAGCATGATTACGGGATTGCTGCCCATGAAGATTGGCGCTTTTGATAATGCGGCCCAGATTAGC
TCTGAGATCCCGACGTATGCGCATTACTTGCGCTCGCGTGGCTACCATACCGCTCTTGCTGGGAAGATGCACTTT
GTGGGCGATCAGTTGCATGGTTACGAGCAGCGCCTTACCAGCGACATCTATCCGGCTGACTTTGGATGGGCTGTC
AATTGGGATGAGCCGGAGACTCGGCTTGAGTGGTATCATAATGCCAGCTCTATCCTGCAGGCTGGACCGTGTGGC
CGCAGCAATCAGCTTGACTATGACGAGGAGGTCATGTTCCGCAGCACGCAGTATCTGTGGGATCATGTTCGGCAG
GGGCCTGGGAAGAGGCCTTTTGCTCTGACGGTCTCTCTCACCCACCCGCACGACCCTTATACCATCACGAGAAAG
TACTGGGATCTCTACGAAGATGTCGACATTGCGCTACCCAAGGCTCGCGTCCCCAAGGACGAGCTCGACGCTCAT
AGCCAGCGCCTCATGCGCGTCTGCGACCTGTGGGATCACGACCTTACCGACGACCAGATCAAGAGGGCCAAGCGC
GCATACTACGGCTCCGTCAGCTACGTCGATGACTGCATCGGCCGTCTGCTCGAGACGTTGCGCGACGCCGGTCTG
GCTGACGACACCATTGTCATCTTCAGCGGCGACCATGGCGATATGCTGGGCGAGCGCGGACTCTGGTACAAGATG
AGCTACTTCGAGTCGTCGGTTCGTGTGCCGCTGCTCGTTCACTACCCGCGCTGGTTCTCGCCTCGTCGCGTGTCG
CAGAATGTGTCGACGCTGGACCTGCTGCCGACCATCTGCGACTTCATCGGCGTCAAGCCTGCGCCTCTTTTGCCA
ATGGATGGCATCAGCATGCTGCCTCATCTTCTGGGCCGCGAGGGCGGGCACGACACCGTCCTGGCCGAGTACACG
GGCGAGGGCACCGTCCGGCCCATCATGATGATCCGCCGTGGGCCTTGGAAGTACATCACCTGTCCGGCCGACGAG
CCGCAGCTGTACAACCTCGACGATGACCCGCTCGAGCTGGATAACCTGGCTCGTCTGCGCAACCAGGCGCCCCAG
AACACCGCGCAGGCCAAGGCAAAGGCCATCTTTGCAGAGTATGATGCTGAGGCCAAGGAGCGGTGGGACTTTGAC
GCCATTACCGCTCAGGTGCTGCAGTCGCAGCGTAGCCGTCGGCTGGTGTGGGATGCGCTGAAGCAGGGTGCCTTT
ACGAGTTGGGACTTTGACCCTGTCGACGATGGCCGGACAAAATACATTCGCTCCACTATACCTCTTGACGAACTC
GAGCGTCGCGCGCGCTACCCGTTTGTCGACTCCAAGGCGTACTCGTTCTCCAAGACGGTCGACTCGACCCGCCGT
ATGGCGACGCTGGGTCTCGACGATGACGAGCTCAAGTCGGTGGAGCAGCTCGTCGCCCGTCTGGCGCAGCTCTCC
AGCAGCATCCAGAGCCTGAAGATGGACATACTCAAAAGCAACCCGCTGCCTCACGCCTCATCCCTCCAAGCGTCT
GCGCAAATCCTCCAGCGCAACCTTCAGACCGTGCTAGACAGCCTCGCCGAAAACGCCGACCTCTTTGGCCGCATG
GCCCTCCACCCGGCGACCAACTATCCCGGCCGCACGCAGGAAGGTGTGCTAACGCAGCTGCTGCGCAAGAAGCTC
GAGCCGGATGTCGAGGAGCTGGTCGTCGAGGGGCGGGAGGCGGCACGGCTTGCTACGGCCGAGGGTGTCGCTGCG
CTGCAGGCTATATGGGATGAGCTGCGGCAGTGGACGCATGATAGGATTGCTACGTATGTTCGTGACGAGGCGGGG
CAGGTGTTTACGGCCGAGGAGCGGGCTGCGGGGACGGAAACGGTGCGCACCGGCTTGAGGCGGGCGCTTGATGAG
GAGAGTGATGATGAGGATGAGGAGGGGGGGGACGAGGAGGATGAGGATGCTGCTGCTGCGGTGAGGGCGCGGCTC
GAGAGGGGACCCGAGCCTGAGACGTTGCTTTGGTTCGCTGCTCGTGGCGACTTTGAACTGCCGAGGAACGTCGAG
TACGAGAGAAAGGTGGGCGTCAACAGGGGCCTTGAGGGTGTCAACATCCCACCTGAGGAGGTGGTGCCCGATGCA
ACAGCCGCGGCTTAG
Gene >Ophun1|4834
ATGTCTCCCGACCTCAACTCACTGCCAGTCTCAGCGCCCCCAACCGGCAAAAAGGGCCCGGACGGCTCACGCCCC
AACATGCTCTACATCATGGCCGATCAGTTGGCGGCGCCGCAGCTGGCCATGTACAACGCCGAGTCGCAGATCAAG
ACGCCCAACCTCGATCGATTGGCGGCCGCATCCGTGCAGTTCGACTCGGCTTACTGTCCCTCGCCGCTGTGCGCG
CCCTCGCGGATGAGCATGATTACGGGATTGCTGCCCATGAAGATTGGCGCTTTTGATAATGCGGCCCAGATTAGC
TCTGAGATCCCGACGTATGCGCATTACTTGCGCTCGCGTGGCTACCATACCGCTCTTGCTGGGAAGATGCACTTT
GTGGGCGATCAGTTGCATGGTTACGAGCAGCGCCTTACCAGCGACATCTATCCGGCTGACTTTGGATGGGCTGTC
AATTGGGATGAGCCGGAGACTCGGCTTGAGTGGTATCATAATGCCAGCTCTATCCTGCAGGCTGGACCGTGTGGC
CGCAGCAATCAGCTTGACTATGACGAGGAGGTCATGTTCCGCAGCACGCAGTATCTGTGGGATCATGTTCGGCAG
GGGCCTGGGAAGAGGCCTTTTGCTCTGACGGTATGTTGCAGTTGATCAAGGCTGGGGGTTTTGAGGCTGATGGTC
GGGATAGGTCTCTCTCACCCACCCGCACGACCCTTATACCATCACGAGAAAGTACTGGGATCTCTACGAAGATGT
CGACATTGCGCTACCCAAGGCTCGCGTCCCCAAGGACGAGCTCGACGCTCATAGCCAGCGCCTCATGCGCGTCTG
CGACCTGTGGGATCACGACCTTACCGACGACCAGATCAAGAGGGCCAAGCGCGCATACTACGGCTCCGTCAGCTA
CGTCGATGACTGCATCGGCCGTCTGCTCGAGACGTTGCGCGACGCCGGTCTGGCTGACGACACCATTGTCATCTT
CAGCGGCGACCATGGCGATATGCTGGGCGAGCGCGGACTCTGGTACAAGATGAGCTACTTCGAGTCGTCGGTTCG
TGTGCCGCTGCTCGTTCACTACCCGCGCTGGTTCTCGCCTCGTCGCGTGTCGCAGAATGTGTCGACGCTGGACCT
GCTGCCGACCATCTGCGACTTCATCGGCGTCAAGCCTGCGCCTCTTTTGCCAATGGATGGCATCAGCATGCTGCC
TCATCTTCTGGGCCGCGAGGGCGGGCACGACACCGTCCTGGCCGAGTACACGGGCGAGGGCACCGTCCGGCCCAT
CATGATGATCCGCCGTGGGCCTTGGAAGTACATCACCTGTCCGGCCGACGAGCCGCAGCTGTACAACCTCGACGA
TGACCCGCTCGAGCTGGATAACCTGGCTCGTCTGCGCAACCAGGCGCCCCAGAACACCGCGCAGGCCAAGGCAAA
GGCCATCTTTGCAGAGTATGATGCTGAGGCCAAGGAGCGGTGGGACTTTGACGCCATTACCGCTCAGGTGCTGCA
GTCGCAGCGTAGCCGTCGGCTGGTGTGGGATGCGCTGAAGCAGGGTGCCTTTACGAGTTGGGACTTTGACCCTGT
CGACGATGGCCGGACAAAGTGAGCAGCTCCCCCATGCCGACTCTTTCGTGATGCAGTGCTGACCAGGACGATTTC
AAGATACATTCGCTCCACTATACCTCTTGACGAACTCGAGCGTCGCGCGCGCTACCCGTTTGTCGACTCCAAGGC
GTACTCGTTCTCCAAGACGGTCGACTCGACCCGCCGGTAAGGGAAGGCGTGTATCGACAGGTTGAACGAGGCAGC
ATCAGGCGAAGCTGCTGCTGCTGCGCATTAGGAGGCGTGACTCCGAAGAGGATGAAAGGGGGAAAAGAGTGGGAC
ATGAGGATCGGTGTTTGGTTGCTTTTTTTCCGCTTGGCTGTCGTTGGGTTGAGGCTCTGCGCATGAAGTCGCTGG
TGGAGCCTGTGGAGTTGTGGAGTCGGGACGGGGCTTAGGGCTGTGGATACTTGGATTGACGCACAGAATGTATGG
CTGCGTTTGTACCTGTTATGTACCGTTTCTTATCACGCACCATCGTCATCATCCTCTTTCTGCGCCCATTTCTCA
GACTTCCAAGTGCCTCGGCCTCTACGACTCTCGCATAGCATCGACCTACGAGTTTAGTTCACTAGTATGGCGACG
CTGGGTCTCGACGATGACGAGCTCAAGTCGGTGGAGCAGCTCGTCGCCCGTCTGGCGCAGCTCTCCAGCAGCATC
CAGAGCCTGAAGATGGACATACTCAAAAGCAACCCGCTGCCTCACGCGTTTGTTTCCCAATCATGCTGTGACGAG
TATCAACTGACACCTCAAACGCATCCTTGCAGCTCATCCCTCCAAGCGTCTGCGCAAATCCTCCAGCGCAACCTT
CAGACCGTGCTAGACAGCCTCGCCGAAAACGCCGACCTCTTTGGCCGCATGGCCCTCCACCCGGCGACCAACTAT
CCCGGCCGCACGCAGGAAGGTGTGCTAACGCAGCTGCTGCGCAAGAAGCTCGAGCCGGATGTCGAGGAGCTGGTC
GTCGAGGGGCGGGAGGCGGCACGGCTTGCTACGGCCGAGGGTGTCGCTGCGCTGCAGGCTATATGGGATGAGCTG
CGGCAGTGGACGCATGATAGGATTGCTACGTATGTTCGTGACGAGGCGGGGCAGGTGTTTACGGCCGAGGAGCGG
GCTGCGGGGACGGAAACGGTGCGCACCGGCTTGAGGCGGGCGCTTGATGAGGAGAGTGATGATGAGGATGAGGAG
GGGGGGGACGAGGAGGATGAGGATGCTGCTGCTGCGGTGAGGGCGCGGCTCGAGAGGGGACCCGAGCCTGAGACG
TTGCTTTGGTTCGCTGCTCGTGGCGACTTTGAACTGCCGAGGAACGTCGAGTACGAGAGAAAGGTGGGCGTCAAC
AGGGGCCTTGAGGGTGTCAACATCCCACCTGAGGAGGTGGTGCCCGATGCAACAGCCGCGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail