Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4832
Gene name
LocationContig_455:7351..12631
Strand+
Gene length (bp)5280
Transcript length (bp)4260
Coding sequence length (bp)4260
Protein length (aa) 1420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20163 DUF6536 Family of unknown function (DUF6536) 4.3E-53 65 214

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 475 497 22
3 509 531 22
4 546 568 22
5 651 673 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4832
MAADPSVGSVELVSRPLPEQEDSKQKVESFRARQFAPRSLLSSWFPSIDDDETKSWRIWISRRSRALMLQITIVC
LIMALNLFFTIFTMARYGSERGIGLIYQGDCETVKRLNQSLHLVINLLSTGMLSASNYCMQLQAAPTRANVDAAH
AQGRWMDIGIPSLRNLRYLTRHRLLTWGLLALSSVPVHLIYNSAVFQSLSSSSYAVAVVKDSFLRGSPWDLIAAD
VRAAGDPAWDESRVSPDYIDYPPIIQDLQLNAASYRRLNVSSCFDVYNDYWKPQGNAIVLVANETVQSPPDDSLL
MYAYIVPRWDDWGKNMWALGNGTRRFVAQSSTHPVTKWYLGPQSYQVAGCLVQDPDGIRLICRFQYSPPIMITIC
LMNVLKVGVMLWSWRTRTGKGPNTGDHQPLYTLGDAIASFMRRPDDMTAGMCLATKDDFLRRRPDKWKPWKSVAP
SPETGPRVYRKQPRLWMEAASRRRWTMLLLLCLCTIAAGGPLLATAVSNLNHRNILTDLGSLSTLGFGATTPFTF
LVTRLPRQDPAGLISSVLLANLPQLLISVIYMLYNAMLSTFLVQREFSLMYKREKHKPLRVSEPIGIQRSSYFIS
LPLRYGVPLYATSGLMHFLLSQSLFMARVTVISPDGTVDTRASFSACAYSPIAIMTTMVMGAALVVAIVALGFRR
YDGTMRMVGTNSRAISAACHVLEEDRAEGFLLPVQWGVVEQSGGVGRCAFTTAAVDETMTLRSLPRMACRIQGSS
SRLLRSKTVCRGVRARFYSEVQAAAAKPSTEPVPPSKAAKGEDPADAVGKEYVRPSREAEKAIYNVLKEFFMGNG
PATRPRHVRKVFEKHKSEVKMTTLIEKYNTETVYKVAYGLLSNGVFSSAIKAEAHFSKPLKVKSGTKREDSTKEE
KQDGQTEKDSELAQNSALDESVTAKGTLFTTDILKVVKANSASTSTPAETDAPVATPSQPPPSPTPNAVAIPVAV
SAETVLSGPLPVPGPIVMPAVETPPPEPVEAPSPVFLPIPAQHQLLTHLQQLLELACFEFCKRSMPEVLEQNNWE
YPEAVELQRWMEEFLRRRHKFPETQKGTGKAIRTLFSAACELRHTTVHRLPTETWRLGEFFALAEGLLVVLGDMV
RADEAAKLRYRMQNVIEELESNKRSQQHQLEEILRRVASQRSELMLLETRAKLEMARMGKEAEIVAGNKVLRFMS
SSGYRSYERTDGGASSDEGQETIQPEARVESKPEAPATEARTDDTPEARAGVSPESPSLEKAKDGVQDEAAAESA
SGDEIANSIREKLARRKALAMAMEAAADANRRAAEAREKLRASKKQESSLRAKEGATALEKTDSQAEEAQDAKGR
EAGVGGNDDGSKLEKAGDVEKQEAERQAAEAQSRDGSNSDTKPETEVTTTGGEKSKGRWWLPSFLTFSK*
Coding >Ophun1|4832
ATGGCAGCAGATCCGTCGGTCGGATCCGTGGAGCTGGTCTCCCGTCCTCTTCCAGAACAAGAGGATAGCAAACAA
AAGGTCGAGAGCTTCCGCGCCCGCCAATTCGCCCCGCGATCTCTCCTCTCGAGCTGGTTCCCCAGCATCGACGAC
GACGAAACCAAGTCATGGCGCATCTGGATCTCTCGCCGGTCTCGCGCGCTGATGCTGCAAATCACAATCGTCTGC
CTCATCATGGCCCTGAACCTCTTCTTCACCATCTTCACCATGGCCAGGTACGGCAGCGAGAGGGGCATCGGCCTC
ATCTACCAGGGAGACTGCGAGACTGTCAAGAGACTCAACCAGTCGCTCCATCTCGTCATCAACCTCCTCAGCACC
GGCATGCTCAGCGCGAGCAATTACTGCATGCAGTTGCAGGCTGCCCCCACCAGAGCAAACGTCGACGCCGCTCAC
GCTCAGGGCAGGTGGATGGACATTGGAATCCCTAGTTTGCGGAACCTCAGATATCTGACTCGTCATCGCCTTCTG
ACCTGGGGCCTTCTCGCGCTGAGCTCTGTCCCCGTTCACTTGATCTACAACTCGGCCGTCTTCCAATCCTTGTCG
TCAAGCAGCTATGCCGTCGCCGTTGTCAAAGATTCTTTTCTCCGTGGCAGCCCCTGGGACTTGATCGCCGCCGAC
GTGCGTGCCGCCGGCGATCCGGCCTGGGACGAGTCTCGCGTCAGTCCAGATTACATCGACTACCCGCCTATCATC
CAAGACTTGCAGCTGAACGCTGCTTCCTATCGACGACTCAACGTCTCATCGTGCTTCGACGTCTACAACGATTAC
TGGAAACCGCAGGGCAACGCCATCGTCCTGGTTGCCAACGAGACGGTCCAAAGCCCGCCAGACGACAGCCTTCTC
ATGTATGCCTACATTGTGCCGCGATGGGATGACTGGGGTAAGAACATGTGGGCGCTGGGAAACGGCACGAGACGC
TTCGTGGCCCAATCTTCGACACATCCGGTGACAAAATGGTATCTCGGACCGCAGAGTTACCAGGTGGCAGGCTGT
CTCGTGCAGGACCCGGATGGAATCCGGCTCATATGTCGTTTCCAGTACTCGCCTCCCATCATGATCACCATCTGT
CTCATGAATGTCCTCAAGGTGGGCGTCATGCTGTGGTCTTGGAGGACGAGGACTGGCAAGGGCCCAAATACGGGC
GATCACCAGCCCCTATACACACTCGGAGACGCCATTGCGTCGTTTATGCGAAGGCCTGACGATATGACGGCTGGC
ATGTGTCTGGCTACAAAGGACGACTTTCTGAGGCGACGCCCCGACAAGTGGAAGCCGTGGAAGTCGGTAGCGCCC
AGCCCGGAGACCGGCCCGAGAGTGTATCGGAAGCAGCCGCGGCTGTGGATGGAAGCTGCTAGCCGGAGACGATGG
ACGATGTTGTTGCTCCTGTGTCTATGCACGATTGCCGCCGGAGGACCTCTGCTGGCCACGGCAGTTTCAAACCTC
AACCATCGCAACATACTCACGGATCTGGGCAGCCTTTCGACGCTCGGCTTTGGGGCCACGACGCCCTTTACGTTT
CTCGTGACGAGGCTGCCCCGTCAAGACCCAGCCGGGCTCATCTCGAGCGTGCTGCTGGCCAATCTGCCGCAGCTG
CTCATCTCCGTCATCTACATGCTCTACAACGCCATGCTGAGCACCTTTCTCGTCCAGCGCGAGTTCAGTCTCATG
TATAAGAGGGAGAAGCACAAGCCACTGAGGGTTTCGGAGCCCATCGGGATCCAGAGGTCGAGCTACTTCATCTCG
CTGCCGCTGAGATACGGCGTGCCGCTGTACGCGACGTCGGGGCTGATGCACTTTCTGCTGAGCCAGAGCCTGTTC
ATGGCCAGGGTCACTGTCATTTCTCCCGATGGCACCGTCGACACGAGGGCGTCGTTTTCGGCGTGCGCCTACAGT
CCCATTGCCATCATGACGACAATGGTCATGGGAGCGGCGCTGGTTGTGGCCATCGTCGCGCTGGGATTTCGCCGA
TACGACGGCACCATGAGGATGGTGGGCACGAACAGCCGGGCCATCAGCGCAGCGTGCCATGTCTTGGAAGAGGAC
CGCGCCGAGGGCTTCCTCTTGCCGGTTCAGTGGGGAGTCGTCGAGCAGTCTGGCGGCGTGGGGAGATGCGCCTTT
ACGACGGCCGCCGTCGACGAGACCATGACGTTGCGGTCGCTTCCAAGGATGGCATGTCGCATTCAAGGCTCGTCA
AGCCGTCTACTGCGCAGCAAGACCGTCTGCCGAGGCGTGAGGGCCCGCTTCTACAGCGAGGTTCAAGCAGCAGCC
GCGAAGCCCAGCACTGAGCCCGTTCCCCCATCTAAGGCGGCGAAAGGAGAGGATCCGGCAGATGCGGTGGGCAAA
GAATACGTGAGACCGAGTCGTGAGGCGGAAAAGGCAATCTACAATGTCCTAAAGGAATTCTTCATGGGCAATGGC
CCGGCGACAAGACCGCGGCACGTGCGGAAGGTGTTTGAGAAGCACAAGTCGGAGGTGAAGATGACCACGCTGATA
GAAAAGTACAATACCGAGACGGTGTACAAGGTGGCGTATGGGTTGTTGAGCAACGGCGTCTTTTCTTCTGCTATC
AAGGCCGAGGCTCACTTCTCTAAACCTCTCAAGGTGAAGTCTGGGACGAAACGCGAGGATTCGACAAAGGAGGAG
AAACAGGACGGTCAGACGGAAAAGGATTCGGAGCTGGCGCAGAATTCAGCTCTCGACGAGTCTGTCACTGCCAAG
GGCACCTTGTTCACGACTGATATCCTCAAAGTCGTCAAAGCAAACTCGGCTTCGACGTCGACTCCCGCCGAGACG
GATGCCCCGGTCGCAACGCCGTCGCAACCTCCCCCGTCACCGACACCAAACGCCGTCGCAATTCCGGTGGCTGTA
TCGGCGGAGACGGTGCTGTCGGGACCGCTCCCGGTGCCGGGTCCCATTGTCATGCCGGCTGTCGAGACGCCGCCG
CCCGAGCCGGTGGAGGCGCCCAGCCCCGTCTTCCTCCCGATCCCGGCGCAGCATCAGCTCTTGACTCATCTACAG
CAGCTGCTTGAGCTCGCTTGCTTCGAGTTTTGCAAGCGGTCGATGCCCGAGGTGCTTGAGCAGAACAATTGGGAA
TATCCCGAGGCGGTGGAGCTGCAACGTTGGATGGAAGAGTTTCTGCGACGAAGGCACAAGTTTCCGGAAACGCAA
AAGGGGACGGGCAAGGCGATCCGGACCTTGTTCAGCGCTGCCTGCGAGTTGCGTCATACCACTGTTCACCGGCTG
CCGACCGAGACGTGGAGGCTCGGCGAGTTTTTCGCCTTGGCCGAGGGGCTTCTCGTCGTGCTGGGAGACATGGTG
CGCGCAGACGAGGCGGCGAAGCTGCGGTACCGGATGCAGAACGTCATCGAGGAGCTCGAGAGCAACAAACGCTCT
CAGCAGCACCAGCTGGAAGAGATCTTGCGGCGCGTCGCCTCGCAGCGGAGCGAGCTGATGCTGCTGGAGACGAGG
GCCAAGCTCGAAATGGCCAGGATGGGCAAAGAAGCTGAGATCGTTGCTGGGAACAAGGTGCTCCGCTTCATGTCG
TCTAGCGGCTACCGATCCTATGAACGCACGGATGGGGGTGCGAGCTCGGACGAGGGTCAGGAGACCATCCAGCCC
GAGGCCCGAGTTGAGTCGAAGCCGGAGGCCCCGGCGACGGAGGCTCGGACTGACGATACGCCCGAGGCGCGAGCC
GGGGTGAGTCCCGAAAGCCCTTCTCTCGAGAAAGCCAAGGACGGGGTCCAGGACGAGGCGGCTGCGGAGTCGGCG
TCGGGCGATGAAATTGCCAATTCAATCCGAGAAAAGCTGGCGCGGAGGAAAGCTTTGGCGATGGCGATGGAGGCG
GCTGCCGATGCTAATAGACGCGCGGCTGAGGCGAGGGAGAAGCTGAGGGCCAGCAAGAAGCAGGAAAGCAGCTTG
AGGGCGAAGGAGGGCGCCACAGCACTGGAAAAGACGGATTCACAGGCGGAGGAAGCCCAGGATGCAAAGGGACGT
GAAGCTGGGGTGGGCGGCAACGACGATGGATCGAAGCTCGAAAAGGCCGGTGACGTTGAGAAACAAGAGGCCGAG
AGACAAGCTGCCGAGGCCCAGTCAAGGGATGGCAGTAACAGTGACACTAAGCCGGAAACCGAGGTGACGACGACT
GGTGGAGAGAAGAGCAAGGGCAGATGGTGGCTACCCAGCTTCCTGACGTTCAGCAAGTAG
Transcript >Ophun1|4832
ATGGCAGCAGATCCGTCGGTCGGATCCGTGGAGCTGGTCTCCCGTCCTCTTCCAGAACAAGAGGATAGCAAACAA
AAGGTCGAGAGCTTCCGCGCCCGCCAATTCGCCCCGCGATCTCTCCTCTCGAGCTGGTTCCCCAGCATCGACGAC
GACGAAACCAAGTCATGGCGCATCTGGATCTCTCGCCGGTCTCGCGCGCTGATGCTGCAAATCACAATCGTCTGC
CTCATCATGGCCCTGAACCTCTTCTTCACCATCTTCACCATGGCCAGGTACGGCAGCGAGAGGGGCATCGGCCTC
ATCTACCAGGGAGACTGCGAGACTGTCAAGAGACTCAACCAGTCGCTCCATCTCGTCATCAACCTCCTCAGCACC
GGCATGCTCAGCGCGAGCAATTACTGCATGCAGTTGCAGGCTGCCCCCACCAGAGCAAACGTCGACGCCGCTCAC
GCTCAGGGCAGGTGGATGGACATTGGAATCCCTAGTTTGCGGAACCTCAGATATCTGACTCGTCATCGCCTTCTG
ACCTGGGGCCTTCTCGCGCTGAGCTCTGTCCCCGTTCACTTGATCTACAACTCGGCCGTCTTCCAATCCTTGTCG
TCAAGCAGCTATGCCGTCGCCGTTGTCAAAGATTCTTTTCTCCGTGGCAGCCCCTGGGACTTGATCGCCGCCGAC
GTGCGTGCCGCCGGCGATCCGGCCTGGGACGAGTCTCGCGTCAGTCCAGATTACATCGACTACCCGCCTATCATC
CAAGACTTGCAGCTGAACGCTGCTTCCTATCGACGACTCAACGTCTCATCGTGCTTCGACGTCTACAACGATTAC
TGGAAACCGCAGGGCAACGCCATCGTCCTGGTTGCCAACGAGACGGTCCAAAGCCCGCCAGACGACAGCCTTCTC
ATGTATGCCTACATTGTGCCGCGATGGGATGACTGGGGTAAGAACATGTGGGCGCTGGGAAACGGCACGAGACGC
TTCGTGGCCCAATCTTCGACACATCCGGTGACAAAATGGTATCTCGGACCGCAGAGTTACCAGGTGGCAGGCTGT
CTCGTGCAGGACCCGGATGGAATCCGGCTCATATGTCGTTTCCAGTACTCGCCTCCCATCATGATCACCATCTGT
CTCATGAATGTCCTCAAGGTGGGCGTCATGCTGTGGTCTTGGAGGACGAGGACTGGCAAGGGCCCAAATACGGGC
GATCACCAGCCCCTATACACACTCGGAGACGCCATTGCGTCGTTTATGCGAAGGCCTGACGATATGACGGCTGGC
ATGTGTCTGGCTACAAAGGACGACTTTCTGAGGCGACGCCCCGACAAGTGGAAGCCGTGGAAGTCGGTAGCGCCC
AGCCCGGAGACCGGCCCGAGAGTGTATCGGAAGCAGCCGCGGCTGTGGATGGAAGCTGCTAGCCGGAGACGATGG
ACGATGTTGTTGCTCCTGTGTCTATGCACGATTGCCGCCGGAGGACCTCTGCTGGCCACGGCAGTTTCAAACCTC
AACCATCGCAACATACTCACGGATCTGGGCAGCCTTTCGACGCTCGGCTTTGGGGCCACGACGCCCTTTACGTTT
CTCGTGACGAGGCTGCCCCGTCAAGACCCAGCCGGGCTCATCTCGAGCGTGCTGCTGGCCAATCTGCCGCAGCTG
CTCATCTCCGTCATCTACATGCTCTACAACGCCATGCTGAGCACCTTTCTCGTCCAGCGCGAGTTCAGTCTCATG
TATAAGAGGGAGAAGCACAAGCCACTGAGGGTTTCGGAGCCCATCGGGATCCAGAGGTCGAGCTACTTCATCTCG
CTGCCGCTGAGATACGGCGTGCCGCTGTACGCGACGTCGGGGCTGATGCACTTTCTGCTGAGCCAGAGCCTGTTC
ATGGCCAGGGTCACTGTCATTTCTCCCGATGGCACCGTCGACACGAGGGCGTCGTTTTCGGCGTGCGCCTACAGT
CCCATTGCCATCATGACGACAATGGTCATGGGAGCGGCGCTGGTTGTGGCCATCGTCGCGCTGGGATTTCGCCGA
TACGACGGCACCATGAGGATGGTGGGCACGAACAGCCGGGCCATCAGCGCAGCGTGCCATGTCTTGGAAGAGGAC
CGCGCCGAGGGCTTCCTCTTGCCGGTTCAGTGGGGAGTCGTCGAGCAGTCTGGCGGCGTGGGGAGATGCGCCTTT
ACGACGGCCGCCGTCGACGAGACCATGACGTTGCGGTCGCTTCCAAGGATGGCATGTCGCATTCAAGGCTCGTCA
AGCCGTCTACTGCGCAGCAAGACCGTCTGCCGAGGCGTGAGGGCCCGCTTCTACAGCGAGGTTCAAGCAGCAGCC
GCGAAGCCCAGCACTGAGCCCGTTCCCCCATCTAAGGCGGCGAAAGGAGAGGATCCGGCAGATGCGGTGGGCAAA
GAATACGTGAGACCGAGTCGTGAGGCGGAAAAGGCAATCTACAATGTCCTAAAGGAATTCTTCATGGGCAATGGC
CCGGCGACAAGACCGCGGCACGTGCGGAAGGTGTTTGAGAAGCACAAGTCGGAGGTGAAGATGACCACGCTGATA
GAAAAGTACAATACCGAGACGGTGTACAAGGTGGCGTATGGGTTGTTGAGCAACGGCGTCTTTTCTTCTGCTATC
AAGGCCGAGGCTCACTTCTCTAAACCTCTCAAGGTGAAGTCTGGGACGAAACGCGAGGATTCGACAAAGGAGGAG
AAACAGGACGGTCAGACGGAAAAGGATTCGGAGCTGGCGCAGAATTCAGCTCTCGACGAGTCTGTCACTGCCAAG
GGCACCTTGTTCACGACTGATATCCTCAAAGTCGTCAAAGCAAACTCGGCTTCGACGTCGACTCCCGCCGAGACG
GATGCCCCGGTCGCAACGCCGTCGCAACCTCCCCCGTCACCGACACCAAACGCCGTCGCAATTCCGGTGGCTGTA
TCGGCGGAGACGGTGCTGTCGGGACCGCTCCCGGTGCCGGGTCCCATTGTCATGCCGGCTGTCGAGACGCCGCCG
CCCGAGCCGGTGGAGGCGCCCAGCCCCGTCTTCCTCCCGATCCCGGCGCAGCATCAGCTCTTGACTCATCTACAG
CAGCTGCTTGAGCTCGCTTGCTTCGAGTTTTGCAAGCGGTCGATGCCCGAGGTGCTTGAGCAGAACAATTGGGAA
TATCCCGAGGCGGTGGAGCTGCAACGTTGGATGGAAGAGTTTCTGCGACGAAGGCACAAGTTTCCGGAAACGCAA
AAGGGGACGGGCAAGGCGATCCGGACCTTGTTCAGCGCTGCCTGCGAGTTGCGTCATACCACTGTTCACCGGCTG
CCGACCGAGACGTGGAGGCTCGGCGAGTTTTTCGCCTTGGCCGAGGGGCTTCTCGTCGTGCTGGGAGACATGGTG
CGCGCAGACGAGGCGGCGAAGCTGCGGTACCGGATGCAGAACGTCATCGAGGAGCTCGAGAGCAACAAACGCTCT
CAGCAGCACCAGCTGGAAGAGATCTTGCGGCGCGTCGCCTCGCAGCGGAGCGAGCTGATGCTGCTGGAGACGAGG
GCCAAGCTCGAAATGGCCAGGATGGGCAAAGAAGCTGAGATCGTTGCTGGGAACAAGGTGCTCCGCTTCATGTCG
TCTAGCGGCTACCGATCCTATGAACGCACGGATGGGGGTGCGAGCTCGGACGAGGGTCAGGAGACCATCCAGCCC
GAGGCCCGAGTTGAGTCGAAGCCGGAGGCCCCGGCGACGGAGGCTCGGACTGACGATACGCCCGAGGCGCGAGCC
GGGGTGAGTCCCGAAAGCCCTTCTCTCGAGAAAGCCAAGGACGGGGTCCAGGACGAGGCGGCTGCGGAGTCGGCG
TCGGGCGATGAAATTGCCAATTCAATCCGAGAAAAGCTGGCGCGGAGGAAAGCTTTGGCGATGGCGATGGAGGCG
GCTGCCGATGCTAATAGACGCGCGGCTGAGGCGAGGGAGAAGCTGAGGGCCAGCAAGAAGCAGGAAAGCAGCTTG
AGGGCGAAGGAGGGCGCCACAGCACTGGAAAAGACGGATTCACAGGCGGAGGAAGCCCAGGATGCAAAGGGACGT
GAAGCTGGGGTGGGCGGCAACGACGATGGATCGAAGCTCGAAAAGGCCGGTGACGTTGAGAAACAAGAGGCCGAG
AGACAAGCTGCCGAGGCCCAGTCAAGGGATGGCAGTAACAGTGACACTAAGCCGGAAACCGAGGTGACGACGACT
GGTGGAGAGAAGAGCAAGGGCAGATGGTGGCTACCCAGCTTCCTGACGTTCAGCAAGTAG
Gene >Ophun1|4832
ATGGCAGCAGATCCGTCGGTCGGATCCGTGGAGCTGGTCTCCCGTCCTCTTCCAGAACAAGAGGATAGCAAACAA
AAGGTCGAGAGCTTCCGCGCCCGCCAATTCGCCCCGCGATCTCTCCTCTCGAGCTGGTTCCCCAGCATCGACGAC
GACGAAACCAAGTCATGGCGCATCTGGATCTCTCGCCGGTCTCGCGCGCTGATGCTGCAAATCACAATCGTCTGC
CTCATCATGGCCCTGAACCTCTTCTTCACCATCTTCACCATGGCCAGGTACGGCAGCGAGAGGGGCATCGGCCTC
ATCTACCAGGGAGACTGCGAGACTGTCAAGAGACTCAACCAGTCGCTCCATCTCGTCATCAACCTCCTCAGCACC
GGCATGCTCAGCGCGAGCAATTACTGCATGCAGTTGCAGGCTGCCCCCACCAGAGCAAACGTCGACGCCGCTCAC
GCTCAGGGCAGGTGGATGGACATTGGAATCCCTAGTTTGCGGAACCTCAGATATCTGACTCGTCATCGCCTTCTG
ACCTGGGGCCTTCTCGCGCTGAGCTCTGTCCCCGTTCACTTGATGTGAGGTTCTTCGACTTCAAACGGCCAAAGA
ATGGTGTTGACAGTCGTGACGACCAGCTACAACTCGGCCGTCTTCCAATCCTTGTCGTCAAGCAGCTATGCCGTC
GCCGTTGTCAAAGATTCTTTTCTCCGTGGCAGCCCCTGGGACTTGATCGCCGCCGACGTGCGTGCCGCCGGCGAT
CCGGCCTGGGACGAGTCTCGCGTCAGTCCAGATTACATCGACTACCCGCCTATCATCCAAGACTTGCAGCTGAAC
GCTGCTTCCTATCGACGACTCAACGTCTCATCGTGCTTCGACGTCTACAACGATTACTGGAAACCGCAGGGCAAC
GCCATCGTCCTGGTTGCCAACGAGACGGTCCAAAGCCCGCCAGACGACAGCCTTCTCATGTATGCCTACATTGTG
CCGCGATGGGATGACTGGGGTAAGAACATGTGGGCGCTGGGAAACGGCACGAGACGCTTCGTGGCCCAATCTTCG
ACACATCCGGTGACAAAATGGTATCTCGGACCGCAGAGTTACCAGGTGGCAGGCTGTCTCGTGCAGGACCCGGAT
GGAATCCGGCTCATATGTCGTTTCCAGTACTCGCCTCCCATCATGATCACCATCTGTCTCATGAATGTCCTCAAG
GTGGGCGTCATGCTGTGGTCTTGGAGGACGAGGACTGGCAAGGGCCCAAATACGGGCGATCACCAGCCCCTATAC
ACACTCGGAGACGCCATTGCGTCGTTTATGCGAAGGCCTGACGATATGACGGCTGGCATGTGTCTGGCTACAAAG
GACGACTTTCTGAGGCGACGCCCCGACAAGTGGAAGCCGTGGAAGTCGGTAGCGCCCAGCCCGGAGACCGGCCCG
AGAGTGTATCGGAAGCAGCCGCGGCTGTGGATGGAAGCTGCTAGCCGGAGACGATGGACGATGTTGTTGCTCCTG
TGAGTTGCATCGAGAAGCCTACCGAGGATATCCGCGTCCTAACGACGAGGTTGCCATCGTCTAGGTGTCTATGCA
CGATTGCCGCCGGAGGACCTCTGCTGGCCACGGCAGTTTCAAACCTCAACCATCGCAACATACTCACGGATCTGG
GCAGCCTTTCGACGCTCGGCTTTGGGGCCACGACGCCCTTTACGTTTCTCGTGACGAGGCTGCCCCGTCAAGACC
CAGCCGGGCTCATCTCGAGCGTGCTGCTGGCCAATCTGCCGCAGCTGCTCATCTCCGTCATCTACATGCTCTACA
ACGCCATGCTGAGCACCTTTCTCGTCCAGCGCGAGTTCAGTCTCATGTATAAGAGGGAGAAGCACAAGCCACTGA
GGGTTTCGGAGCCCATCGGGATCCAGAGGTCGAGCTACTTCATCTCGCTGCCGCTGAGATACGGCGTGCCGCTGT
ACGCGACGTCGGGGCTGATGCACTTTCTGCTGAGCCAGAGCCTGTTCATGGCCAGGGTCACTGTCATTTCTCCCG
ATGGCACCGTCGACACGAGGGCGTCGTTTTCGGCGTGCGCCTACAGTCCCATTGCCATCATGACGAGTAGGTCAA
CCGCCGGTCATGGATACCCAATGTCTAACGCCTTCGCAGCAATGGTCATGGGAGCGGCGCTGGTTGTGGCCATCG
TCGCGCTGGGATTTCGCCGATACGACGGCACCATGAGGATGGTGGGCACGAACAGCCGGGCCATCAGCGCAGCGT
GCCATGTCTTGGAAGAGGACCGCGCCGAGGGCTTCCTCTTGCCGGTTCAGTGGGGAGTCGTCGAGCAGTCTGGCG
GCGTGGGGAGATGCGCCTTTACGACGGCCGCCGTCGACGAGGTCAGAGAGCCGAGGGAAGGGATGGAGTATTGGT
AGCGGCAGCTCGACGGGGCAACGAGGCTCGACCTGAGGGTCGGGAGATTATCCACGTGTTGTCTGGTATGCAAAG
TCCCTGGGTCTACCTCTGTGCAAGGTCCTACGAGGATTGGCGCTATTGTTTCCCGGTCAGCCGGAGGCACGTTCC
TCGACTAGCTACAAGCGCTTGACGGGTTGGGCGAGGAGCGAGCTTAAGTTTGGGTCGCGTGATGGCAAGGTGACA
AATGATGGAGTTGGATTCATCTGAGCTGGGGTAGATGAGCTTCGACGGGGGACTGGCCATGGCGCTTCTGGTTTT
GATGGTCAAGGGTTGTCTGTTGGTCGTCTCTTGGTTGAGAACTGTCGCTCAAGGTTCTTTGAAGGTTAGTCACGG
AGATGACGCTGATATTGCATCGTCGTATCGTACTGGCTTTTGTATCAATGCAGCGCTCACATTGGGACTTCTGTC
ATGATGACGAATCGCTAAGAAGAGCGTGAGATGGAAGAGTCGATAACCAAGACCAACGGTGTGGTCCGCAAAACT
TCCGGAAGTCTCCGAGACATCGTCATTGGTTTGGCTTCGCGATACGTGATTAGTCAGATTAGCGAATAGAGTAGC
TCCGATAAGAGCTGATCTCCGATAGTGGTGATAAGCGAAGAAAATTTAGCTGGCGGTCGTCTTCATCAAGGCTCT
GCACTGAAGCGCATGCTGAAGACCATGACGTTGCGGTCGCTTCCAAGGATGGCATGTCGCATTCAAGGCTCGTCA
AGCCGTCTACTGCGCAGCAAGACCGTCTGCCGAGGCGTGAGGGCCCGCTTCTACAGCGAGGTTCAAGCAGCAGCC
GCGAAGCCCAGCACTGAGCCCGTTCCCCCATCTAAGGCGGCGAAAGGAGAGGATCCGGCAGATGCGGTGGGCAAA
GAATACGTGAGACCGAGTCGTGAGGCGGAAAAGGCAATCTACAATGTCCTAAAGGAATTCTTCATGGGCAATGGC
CCGGCGACAAGACCGCGGCACGTGCGGAAGGTGTTTGAGAAGCACAAGTCGGAGGTGAAGATGACCACGCTGATA
GAAAAGTACAATACCGAGACGGTGTACAAGGTGGCGTATGGGTTGTTGAGCAACGGCGTCTTTTCTTCTGCTATC
AAGGCCGAGGCTCACTTCTCTAAACCTCTCAAGGTGAAGTCTGGGACGAAACGCGAGGATTCGACAAAGGAGGAG
AAACAGGACGGTCAGACGGAAAAGGATTCGGAGCTGGCGCAGAATTCAGGTATGTTCTGGGACGGCCTTGCGAAG
ACTGCGACCCGACGCTGATGCTGATTTTGGGGGTGAATGAAGCTCTCGACGAGTCTGTCACTGCCAAGGGCACCT
TGTTCACGACTGATATCCTCAAAGTCGTCAAAGCAAACTCGGCTTCGACGTCGACTCCCGCCGAGACGGATGCCC
CGGTCGCAACGCCGTCGCAACCTCCCCCGTCACCGACACCAAACGCCGTCGCAATTCCGGTGGCTGTATCGGCGG
AGACGGTGCTGTCGGGACCGCTCCCGGTGCCGGGTCCCATTGTCATGCCGGCTGTCGAGACGCCGCCGCCCGAGC
CGGTGGAGGCGCCCAGCCCCGTCTTCCTCCCGATCCCGGCGCAGCATCAGCTCTTGACTCATCTACAGCAGCTGC
TTGAGCTCGCTTGCTTCGAGTTTTGCAAGCGGTCGATGCCCGAGGTGCTTGAGCAGAACAATTGGGAATATCCCG
AGGCGGTGGAGCTGCAACGTTGGATGGAAGAGTTTCTGCGACGAAGGCACAAGTTTCCGGAAACGCAAAAGGGGA
CGGGCAAGGCGATCCGGACCTTGTTCAGCGCTGCCTGCGAGTTGCGTCATACCACTGTTCACCGGCTGCCGACCG
AGACGTGGAGGCTCGGCGAGTTTTTCGCCTTGGCCGAGGGGCTTCTCGTCGTGCTGGGAGACATGGTGCGCGCAG
ACGAGGCGGCGAAGCTGCGGTACCGGATGCAGAACGTCATCGAGGAGCTCGAGAGCAACAAACGCTCTCAGCAGC
ACCAGCTGGAAGAGATCTTGCGGCGCGTCGCCTCGCAGCGGAGCGAGCTGATGCTGCTGGAGACGAGGGCCAAGC
TCGAAATGGCCAGGATGGGCAAAGAAGCTGAGATCGTTGCTGGGAACAAGGTGCTCCGCTTCATGTCGTCTAGCG
GCTACCGATCCTATGAACGCACGGATGGGGGTGCGAGCTCGGACGAGGGTCAGGAGACCATCCAGCCCGAGGCCC
GAGTTGAGTCGAAGCCGGAGGCCCCGGCGACGGAGGCTCGGACTGACGATACGCCCGAGGCGCGAGCCGGGGTGA
GTCCCGAAAGCCCTTCTCTCGAGAAAGCCAAGGACGGGGTCCAGGACGAGGCGGCTGCGGAGTCGGCGTCGGGCG
ATGAAATTGCCAATTCAATCCGAGAAAAGCTGGCGCGGAGGAAAGCTTTGGCGATGGCGATGGAGGCGGCTGCCG
ATGCTAATAGACGCGCGGCTGAGGCGAGGGAGAAGCTGAGGGCCAGCAAGAAGCAGGAAAGCAGCTTGAGGGCGA
AGGAGGGCGCCACAGCACTGGAAAAGACGGATTCACAGGCGGAGGAAGCCCAGGATGCAAAGGGACGTGAAGCTG
GGGTGGGCGGCAACGACGATGGATCGAAGCTCGAAAAGGCCGGTGACGTTGAGAAACAAGAGGCCGAGAGACAAG
CTGCCGAGGCCCAGTCAAGGGATGGCAGTAACAGTGACACTAAGCCGGAAACCGAGGTGAGTTCAAGCTACGGCG
TCACGAGAACCAAGCTGACAGATTGCATTACAGGTGACGACGACTGGTGGAGAGAAGAGCAAGGGCAGATGGTGG
CTACCCAGCTTCCTGACGTTCAGCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail