Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4830
Gene name
LocationContig_455:4151..5686
Strand+
Gene length (bp)1535
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.8E-11 43 276
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-11 262 412

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 45 412 2.0E-30

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 97 114 17
3 124 146 22
4 155 177 22
5 187 206 19
6 241 263 22
7 273 295 22
8 302 319 17
9 324 346 22
10 359 381 22
11 391 410 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4830
MSAHEPLLPPAPPGTGPISLPEDEAERWNRPRGNIGKLVFASLSFALVGMNDASIGLEDFYGISYAYISIIFLTP
FVGYSIAAFTNANVHHHLGQRGIVIIAPLCHVATYLVLATHPPYPVLVIANAVSGFGNGLVDGCFCAWVGVMHRG
NSIQGLMHACYCVGALLSPLLATSMVIKAELPWYTFYYVMISVSLLELVGLCICFWEKSGAVYRAQHAGEHGSSQ
GGTSEALRSPVTWLCALFFFVYMGAEVGLGGWIVTFMLRVRHASPFAAGLSSSGFWAGMALGRALLGFVTERFGE
RICLTIYLVICIILQLVFWLVPNFVVSAIAVVLLGFFLGPMFPGGVMLTAKLLPRRIHVSAIGFAMAVGGSGGTI
FPFVIGAVAASQGVRVLQPIVLALIVLNIVFWVSFPRVNRRA*
Coding >Ophun1|4830
ATGTCCGCCCACGAACCGCTCCTCCCTCCGGCTCCCCCCGGCACCGGCCCCATCTCCCTCCCGGAAGACGAAGCC
GAGCGATGGAACCGGCCGCGCGGGAACATCGGGAAGCTGGTGTTTGCGTCGCTTTCCTTTGCGCTCGTTGGCATG
AATGATGCTTCCATTGGCCTCGAAGACTTCTACGGCATCAGCTACGCCTACATCTCCATCATCTTCCTCACCCCC
TTCGTCGGCTACTCCATCGCCGCCTTCACAAACGCAAACGTTCACCACCACCTCGGCCAGCGAGGCATCGTCATC
ATCGCACCGCTATGCCACGTCGCAACCTACCTCGTCCTCGCAACTCACCCTCCCTACCCCGTCCTCGTCATCGCC
AATGCCGTCAGCGGCTTTGGAAACGGCCTTGTCGACGGCTGCTTTTGCGCTTGGGTTGGCGTTATGCATCGCGGC
AATTCGATACAGGGGTTGATGCATGCTTGTTATTGTGTTGGCGCTTTGCTTTCGCCTTTGCTTGCCACTTCCATG
GTTATCAAGGCTGAGCTTCCGTGGTATACGTTTTACTACGTCATGATCAGCGTCTCTTTGCTTGAGCTTGTCGGC
CTTTGCATCTGCTTCTGGGAAAAATCCGGCGCCGTTTACCGAGCACAACACGCCGGCGAACACGGCTCTTCCCAA
GGCGGCACCTCGGAAGCCCTCAGATCGCCGGTAACCTGGCTATGTGCCCTCTTCTTCTTCGTCTACATGGGCGCC
GAAGTCGGCCTCGGCGGCTGGATCGTCACCTTCATGCTCCGCGTCCGCCACGCCTCCCCCTTCGCCGCCGGCCTC
TCCAGCTCCGGCTTCTGGGCCGGCATGGCGCTGGGTCGCGCGCTGCTAGGCTTCGTGACGGAGCGGTTCGGCGAA
CGCATCTGTCTGACCATCTACCTCGTCATCTGCATCATCCTCCAGCTCGTCTTCTGGCTCGTTCCGAACTTTGTC
GTATCTGCCATTGCTGTTGTCCTGCTTGGCTTCTTCTTAGGTCCCATGTTTCCAGGCGGCGTCATGTTGACGGCC
AAGCTGCTTCCGCGCCGGATTCATGTCAGTGCCATTGGCTTTGCCATGGCTGTGGGCGGTAGCGGAGGCACCATT
TTCCCATTCGTTATCGGTGCTGTTGCTGCTAGTCAGGGTGTCAGGGTGTTGCAGCCCATAGTTCTCGCTCTCATC
GTCCTCAACATCGTCTTCTGGGTTAGCTTTCCTCGCGTCAACAGGAGGGCTTGA
Transcript >Ophun1|4830
ATGTCCGCCCACGAACCGCTCCTCCCTCCGGCTCCCCCCGGCACCGGCCCCATCTCCCTCCCGGAAGACGAAGCC
GAGCGATGGAACCGGCCGCGCGGGAACATCGGGAAGCTGGTGTTTGCGTCGCTTTCCTTTGCGCTCGTTGGCATG
AATGATGCTTCCATTGGCCTCGAAGACTTCTACGGCATCAGCTACGCCTACATCTCCATCATCTTCCTCACCCCC
TTCGTCGGCTACTCCATCGCCGCCTTCACAAACGCAAACGTTCACCACCACCTCGGCCAGCGAGGCATCGTCATC
ATCGCACCGCTATGCCACGTCGCAACCTACCTCGTCCTCGCAACTCACCCTCCCTACCCCGTCCTCGTCATCGCC
AATGCCGTCAGCGGCTTTGGAAACGGCCTTGTCGACGGCTGCTTTTGCGCTTGGGTTGGCGTTATGCATCGCGGC
AATTCGATACAGGGGTTGATGCATGCTTGTTATTGTGTTGGCGCTTTGCTTTCGCCTTTGCTTGCCACTTCCATG
GTTATCAAGGCTGAGCTTCCGTGGTATACGTTTTACTACGTCATGATCAGCGTCTCTTTGCTTGAGCTTGTCGGC
CTTTGCATCTGCTTCTGGGAAAAATCCGGCGCCGTTTACCGAGCACAACACGCCGGCGAACACGGCTCTTCCCAA
GGCGGCACCTCGGAAGCCCTCAGATCGCCGGTAACCTGGCTATGTGCCCTCTTCTTCTTCGTCTACATGGGCGCC
GAAGTCGGCCTCGGCGGCTGGATCGTCACCTTCATGCTCCGCGTCCGCCACGCCTCCCCCTTCGCCGCCGGCCTC
TCCAGCTCCGGCTTCTGGGCCGGCATGGCGCTGGGTCGCGCGCTGCTAGGCTTCGTGACGGAGCGGTTCGGCGAA
CGCATCTGTCTGACCATCTACCTCGTCATCTGCATCATCCTCCAGCTCGTCTTCTGGCTCGTTCCGAACTTTGTC
GTATCTGCCATTGCTGTTGTCCTGCTTGGCTTCTTCTTAGGTCCCATGTTTCCAGGCGGCGTCATGTTGACGGCC
AAGCTGCTTCCGCGCCGGATTCATGTCAGTGCCATTGGCTTTGCCATGGCTGTGGGCGGTAGCGGAGGCACCATT
TTCCCATTCGTTATCGGTGCTGTTGCTGCTAGTCAGGGTGTCAGGGTGTTGCAGCCCATAGTTCTCGCTCTCATC
GTCCTCAACATCGTCTTCTGGGTTAGCTTTCCTCGCGTCAACAGGAGGGCTTGA
Gene >Ophun1|4830
ATGTCCGCCCACGAACCGCTCCTCCCTCCGGCTCCCCCCGGCACCGGCCCCATCTCCCTCCCGGAAGACGAAGCC
GAGCGATGGAACCGGCCGCGCGGGAACATCGGGAAGCTGGTGTTTGCGTCGCTTTCCTTTGCGCTCGTTGGCATG
AATGATGCTTCCATTGGCGTGCGTCTTGTCCTCTTCCGTCGTGTTCCCATACGAATACACACCTACATATTCGTA
CTTACATATATACTGACACCTCTCTTATATCTAGGCGCTGCTTCCATACGTACAATCTCTCTTACACGCCCTCCT
CTGCTCCCCCCAACTAAAACCCAACAGCTCGAAGACTTCTACGGCATCAGCTACGCCTACATCTCCATCATCTTC
CTCACCCCCTTCGTCGGCTACTCCATCGCCGCCTTCACAAACGCAAACGTTCACCACCACCTCGGCCAGCGAGGC
ATCGTCATCATCGCACCGCTATGCCACGTCGCAACCTACCTCGTCCTCGCAACTCACCCTCCCTACCCCGTCCTC
GTCATCGCCAATGCCGTCAGCGGCTTTGGAAACGGCCTTGTCGACGGCTGCTTTTGCGCTTGGGTTGGCGTTATG
CATCGCGGCAATTCGATACAGGGGTTGATGCATGCTTGTTATTGTGTTGGCGCTTTGCTTTCGCCTTTGCTTGCC
ACTTCCATGGTTATCAAGGCTGAGCTTCCGTGGTATACGTTTTACTACGTCATGGTGAGTTCTCGTCGTCTTGCA
TCTCGTCTTGCTGATTTTCTTCCTTCCTTCTTACGAATGACGTCTCTGTTAGATCAGCGTCTCTTTGCTTGAGCT
TGTCGGCCTTTGCATCTGCTTCTGGGAAAAATCCGGCGCCGTTTACCGAGCACAACACGCCGGCGAACACGGCTC
TTCCCAAGGCGGCACCTCGGAAGCCCTCAGATCGCCGGTAACCTGGCTATGTGCCCTCTTCTTCTTCGTCTACAT
GGGCGCCGAAGGTATATACACACCCAACCCATCATCCACCCTCCCTCTAACGCTCAACAGTCGGCCTCGGCGGCT
GGATCGTCACCTTCATGCTCCGCGTCCGCCACGCCTCCCCCTTCGCCGCCGGCCTCTCCAGCTCCGGCTTCTGGG
CCGGCATGGCGCTGGGTCGCGCGCTGCTAGGCTTCGTGACGGAGCGGTTCGGCGAACGCATCTGTCTGACCATCT
ACCTCGTCATCTGCATCATCCTCCAGCTCGTCTTCTGGCTCGTTCCGAACTTTGTCGTATCTGCCATTGCTGTTG
TCCTGCTTGGCTTCTTCTTAGGTCCCATGTTTCCAGGCGGCGTCATGTTGACGGCCAAGCTGCTTCCGCGCCGGA
TTCATGTCAGTGCCATTGGCTTTGCCATGGCTGTGGGCGGTAGCGGAGGCACCATTTTCCCATTCGTTATCGGTG
CTGTTGCTGCTAGTCAGGGTGTCAGGGTGTTGCAGCCCATAGTTCTCGCTCTCATCGTCCTCAACATCGTCTTCT
GGGTTAGCTTTCCTCGCGTCAACAGGAGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail