Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|483
Gene name
LocationContig_114:5898..7386
Strand+
Gene length (bp)1488
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 7.3E-34 56 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 24 466 2.0E-24
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 20 471 6.0E-22
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 2 470 1.0E-20
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 2 470 1.0E-20
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 14 470 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 24 466 2.0E-24
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 20 471 6.0E-22
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 2 470 1.0E-20
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 2 470 1.0E-20
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 14 470 4.0E-18
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 2 470 5.0E-17
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 112 470 6.0E-17
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 1 470 4.0E-16
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 308 470 1.0E-14
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 167 470 2.0E-14
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 308 471 1.0E-13
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 276 466 2.0E-13
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 276 466 2.0E-13
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 309 493 2.0E-13
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 158 471 3.0E-13
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 74 470 3.0E-13
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 252 466 7.0E-13
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 276 470 8.0E-13
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 165 466 8.0E-13
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 317 470 9.0E-13
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 75 470 2.0E-12
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 98 470 2.0E-12
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 60 470 3.0E-12
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 112 470 3.0E-12
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 98 470 4.0E-12
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 28 470 5.0E-12
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 291 470 9.0E-12
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 156 470 1.0E-11
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 76 470 1.0E-11
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 75 470 1.0E-11
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 76 470 1.0E-11
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 156 470 1.0E-11
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 151 470 1.0E-11
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 307 470 1.0E-11
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 156 470 1.0E-11
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 138 470 4.0E-11
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 314 473 4.0E-11
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 273 466 4.0E-11
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 76 470 4.0E-11
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 6 471 4.0E-11
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 308 470 4.0E-11
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 315 472 4.0E-11
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 101 470 4.0E-11
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 308 470 4.0E-11
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 112 473 4.0E-11
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 308 470 5.0E-11
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 136 470 5.0E-11
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 109 470 6.0E-11
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 150 470 6.0E-11
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 308 470 7.0E-11
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 156 470 7.0E-11
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 151 477 8.0E-11
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 5 471 8.0E-11
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 284 467 8.0E-11
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 308 492 8.0E-11
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 315 470 1.0E-10
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 314 471 1.0E-10
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 150 470 1.0E-10
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 317 470 1.0E-10
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 309 470 2.0E-10
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 315 476 2.0E-10
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 87 471 2.0E-10
sp|P82713|CP392_DROME Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 167 470 2.0E-10
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 260 494 2.0E-10
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 315 470 2.0E-10
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 245 470 2.0E-10
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 302 470 2.0E-10
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 308 471 2.0E-10
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 156 473 3.0E-10
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 56 470 3.0E-10
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 138 470 3.0E-10
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 56 470 3.0E-10
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 23 470 3.0E-10
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 112 470 3.0E-10
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 307 470 4.0E-10
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 315 470 4.0E-10
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 309 470 5.0E-10
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 309 470 6.0E-10
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 152 466 6.0E-10
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 304 470 7.0E-10
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 304 470 7.0E-10
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 314 466 7.0E-10
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 312 476 7.0E-10
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 96 471 7.0E-10
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 304 470 8.0E-10
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 308 466 8.0E-10
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 167 470 9.0E-10
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 309 470 1.0E-09
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 74 470 1.0E-09
sp|Q9VRI9|CP6T1_DROME Probable cytochrome P450 6t1 OS=Drosophila melanogaster GN=Cyp6t1 PE=2 SV=1 167 467 1.0E-09
sp|Q8GSQ1|C85A1_ORYSJ Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 317 467 1.0E-09
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 308 472 1.0E-09
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 284 470 1.0E-09
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 285 470 1.0E-09
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 291 470 1.0E-09
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 284 467 1.0E-09
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 285 470 1.0E-09
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 302 466 1.0E-09
sp|Q7XU38|C87A3_ORYSJ Cytochrome P450 87A3 OS=Oryza sativa subsp. japonica GN=CYP87A3 PE=2 SV=3 317 470 2.0E-09
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 305 470 2.0E-09
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 308 470 2.0E-09
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 251 471 2.0E-09
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 152 466 2.0E-09
sp|P10614|CP51_YEAST Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 294 471 2.0E-09
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 291 466 2.0E-09
sp|O13820|ERG5_SCHPO Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 280 484 2.0E-09
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 300 472 2.0E-09
sp|P14137|CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 308 493 2.0E-09
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 308 472 2.0E-09
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 314 467 2.0E-09
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 295 471 2.0E-09
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 152 481 2.0E-09
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 308 470 2.0E-09
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 308 470 3.0E-09
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 306 470 3.0E-09
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 308 494 3.0E-09
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 308 470 3.0E-09
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 319 470 3.0E-09
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 298 488 4.0E-09
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 152 470 4.0E-09
sp|Q50EK5|C72B2_PINTA Cytochrome P450 720B2 OS=Pinus taeda GN=CYP720B2 PE=2 SV=1 317 470 4.0E-09
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 308 470 4.0E-09
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 308 470 4.0E-09
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 234 474 4.0E-09
sp|Q9V676|CP6T3_DROME Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 309 470 5.0E-09
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 152 466 5.0E-09
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 308 466 5.0E-09
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 308 470 5.0E-09
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 314 466 5.0E-09
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 308 470 6.0E-09
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 56 470 6.0E-09
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 167 476 6.0E-09
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 167 470 6.0E-09
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 309 470 6.0E-09
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 93 470 6.0E-09
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 308 470 7.0E-09
sp|Q09736|CP51_SCHPO Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 308 481 8.0E-09
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 152 466 9.0E-09
sp|P50859|CP51_CANGA Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 308 471 9.0E-09
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 309 470 1.0E-08
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 317 470 1.0E-08
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 307 494 1.0E-08
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 285 466 1.0E-08
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 308 470 1.0E-08
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 284 476 1.0E-08
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 152 471 1.0E-08
sp|P05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 308 470 1.0E-08
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 314 492 1.0E-08
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 96 471 2.0E-08
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 239 477 2.0E-08
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 311 472 2.0E-08
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 307 471 2.0E-08
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 96 471 2.0E-08
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 308 470 2.0E-08
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 309 470 2.0E-08
sp|Q50LE0|C85A3_SOLLC Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CYP85A3 PE=2 SV=1 303 470 2.0E-08
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 306 470 2.0E-08
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 308 472 2.0E-08
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 231 472 2.0E-08
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 308 472 2.0E-08
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 158 470 2.0E-08
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 308 472 3.0E-08
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 323 466 4.0E-08
sp|Q64562|CP21A_RAT Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 280 470 4.0E-08
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 317 470 4.0E-08
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 280 470 4.0E-08
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 64 470 4.0E-08
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 317 470 4.0E-08
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 280 470 4.0E-08
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 308 472 5.0E-08
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 309 470 5.0E-08
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 308 478 5.0E-08
sp|Q43147|C85A1_SOLLC Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1 276 470 5.0E-08
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 100 481 6.0E-08
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 308 466 6.0E-08
sp|Q5Z5R7|C701S_ORYSJ Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 315 467 6.0E-08
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 299 471 6.0E-08
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 308 470 7.0E-08
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 308 470 7.0E-08
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 152 470 7.0E-08
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 317 467 7.0E-08
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 314 470 7.0E-08
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 313 470 8.0E-08
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 167 466 9.0E-08
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 308 470 9.0E-08
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 323 466 9.0E-08
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 309 467 1.0E-07
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 306 472 1.0E-07
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 317 470 1.0E-07
sp|Q9VWR2|CP308_DROME Probable cytochrome P450 308a1 OS=Drosophila melanogaster GN=Cyp308a1 PE=2 SV=2 308 487 1.0E-07
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 303 470 1.0E-07
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 317 470 1.0E-07
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 60 470 1.0E-07
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 309 470 1.0E-07
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 307 472 1.0E-07
sp|B1NF20|C719E_ARGME Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 320 466 1.0E-07
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 64 470 2.0E-07
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 309 470 2.0E-07
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 250 470 2.0E-07
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 168 489 2.0E-07
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 300 470 2.0E-07
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 309 470 3.0E-07
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 89 481 3.0E-07
sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 168 470 3.0E-07
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 308 470 3.0E-07
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 309 466 3.0E-07
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 308 470 3.0E-07
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 209 470 3.0E-07
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 252 470 3.0E-07
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 323 470 3.0E-07
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 308 494 3.0E-07
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 151 476 4.0E-07
sp|I7C6E8|C7A52_PANGI Beta-amyrin 28-oxidase OS=Panax ginseng PE=2 SV=1 308 470 4.0E-07
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 120 470 4.0E-07
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 267 470 4.0E-07
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 209 470 5.0E-07
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 317 470 5.0E-07
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 313 466 5.0E-07
sp|Q1ZXI7|C513F_DICDI Probable cytochrome P450 513F1 OS=Dictyostelium discoideum GN=cyp513F1 PE=3 SV=1 309 470 5.0E-07
sp|O14442|CP51_UNCNE Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 308 470 6.0E-07
sp|Q9VRB3|CP6V1_DROME Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 303 466 7.0E-07
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 308 470 7.0E-07
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 315 470 7.0E-07
sp|Q9VQD2|CP391_DROME Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 318 466 8.0E-07
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 110 466 9.0E-07
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 319 466 9.0E-07
sp|Q92111|CP19A_ICTPU Aromatase OS=Ictalurus punctatus GN=cyp19a1 PE=2 SV=1 242 470 9.0E-07
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 315 466 1.0E-06
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 295 470 1.0E-06
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 315 469 1.0E-06
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 308 472 1.0E-06
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 315 481 1.0E-06
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 306 469 1.0E-06
sp|Q54SV9|C515B_DICDI Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 236 470 1.0E-06
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 315 481 1.0E-06
sp|Q9FMA5|C85A1_ARATH Cytochrome P450 85A1 OS=Arabidopsis thaliana GN=CYP85A1 PE=2 SV=1 308 470 1.0E-06
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 252 470 1.0E-06
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 284 466 1.0E-06
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 309 470 1.0E-06
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 308 470 1.0E-06
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 250 471 2.0E-06
sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 246 470 2.0E-06
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 313 484 2.0E-06
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 308 472 3.0E-06
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 308 470 3.0E-06
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 319 467 3.0E-06
sp|Q69F95|C85A_PHAVU Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2 276 476 3.0E-06
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 204 466 3.0E-06
sp|H2DH16|C7A47_PANGI Dammarenediol 12-hydroxylase OS=Panax ginseng GN=PPDS PE=1 SV=2 308 470 3.0E-06
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 305 470 3.0E-06
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 309 464 3.0E-06
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 308 470 3.0E-06
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 308 471 5.0E-06
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 305 470 5.0E-06
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 309 477 6.0E-06
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 261 470 6.0E-06
sp|O64989|C90B1_ARATH Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 317 470 7.0E-06
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 303 473 7.0E-06
sp|P9WPN1|C135A_MYCTU Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 308 470 7.0E-06
sp|P9WPN0|C135A_MYCTO Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 308 470 7.0E-06
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 308 470 8.0E-06
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 317 470 9.0E-06
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 308 470 9.0E-06
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 261 470 9.0E-06
sp|Q9SRQ1|C89A9_ARATH Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 308 466 9.0E-06
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 308 470 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|483
MLILLLAALAAAYGLYSYLLLPLFFSPLSRLPTPHWSCALSSFWILRARKRFSETKTLSDAHSRHGPIVRVGPRT
LSVNSVDAVRTIYQGGFDKWSWYSVFDFYGVHCVFSTLGSHEHGQRKRIVSRVYSKSYIQSSPAVKAQGKAILLG
RLLPLLRREAVHSEGTEIQSVILSTTMDLISAFNFGVQAGTNFVQDVEYGRYWTGLYSYRFLHFFWPQEFPTLTS
LCSKLGFRLYPSSADKVHQEIEDWNKRMCDKARDVLDGEKSELPPQDEPIVLRALYEGMEKAQEPKGEKAAPSRT
SIQHRHLEVASETMDHILAGFETSGIALVFLIWRLSQNPGLQDELRAELLTVKAPTPDVLPESRDLDTLPLLHAL
VMETLRRHPPISGCQPRITPYPSSNIAGFQIPGGVRISAMPGPLHLDETVFPDPLRWDHTRWLPGVKSEEEMKQM
NRNFWAFGSGGRMCLGSNFAWNSTSAPTRKMNVLTQDKVSTKSPT*
Coding >Ophun1|483
ATGCTGATCCTCCTTCTCGCCGCCTTGGCCGCGGCCTACGGGCTCTATTCATACCTTCTCCTCCCCCTCTTCTTC
TCCCCGCTCTCCCGGCTTCCAACCCCGCACTGGTCCTGCGCTCTTTCAAGTTTCTGGATTCTCCGGGCTCGGAAG
CGGTTCAGCGAGACCAAGACGCTCAGTGATGCCCATTCTCGCCATGGCCCCATCGTCAGGGTCGGCCCCAGAACC
CTCAGCGTCAACAGCGTCGATGCCGTCAGGACCATCTATCAGGGAGGCTTCGACAAGTGGTCGTGGTATTCCGTC
TTCGACTTTTACGGCGTGCACTGCGTCTTCTCCACCCTCGGCTCTCATGAACACGGCCAGAGGAAACGCATCGTC
TCGCGCGTTTACTCCAAGTCATATATCCAGTCGTCGCCTGCCGTCAAAGCCCAGGGCAAGGCTATTCTGCTGGGC
CGACTTCTCCCTCTGCTTCGACGCGAAGCTGTCCATTCAGAGGGTACCGAGATACAGTCCGTCATCTTGTCGACG
ACAATGGACCTCATCTCTGCCTTCAACTTCGGAGTGCAAGCAGGAACTAATTTTGTCCAGGACGTCGAGTACGGC
CGGTATTGGACAGGCCTCTACAGCTACAGATTCCTTCACTTCTTCTGGCCTCAAGAGTTCCCGACCCTGACGTCT
CTGTGCTCCAAGCTCGGGTTCCGGCTTTATCCCTCTTCCGCCGACAAGGTGCACCAAGAAATCGAGGATTGGAAC
AAGCGTATGTGTGACAAGGCTCGAGACGTACTCGATGGAGAAAAGTCGGAGCTCCCTCCTCAGGATGAACCGATC
GTCTTGCGAGCCCTCTACGAAGGCATGGAGAAAGCCCAAGAGCCCAAGGGCGAGAAAGCGGCTCCCAGCAGGACA
TCTATCCAGCACCGACATCTCGAGGTCGCTAGCGAGACGATGGACCACATATTAGCTGGGTTTGAAACCTCTGGC
ATCGCCTTGGTCTTCCTGATTTGGCGGCTGTCCCAGAACCCGGGGCTTCAAGACGAGCTCCGAGCTGAGCTCCTC
ACCGTCAAAGCCCCAACCCCAGACGTCCTCCCCGAGTCCAGAGACTTGGACACCTTACCGCTCCTTCACGCTCTC
GTCATGGAGACGCTTCGACGTCACCCCCCGATCTCTGGTTGCCAGCCGCGCATAACGCCATACCCTTCCAGTAAC
ATCGCCGGTTTCCAAATCCCCGGGGGAGTCCGAATCTCGGCCATGCCCGGCCCTCTACATCTCGACGAGACTGTC
TTTCCGGATCCGCTTCGGTGGGACCACACGAGGTGGCTCCCCGGCGTGAAGTCGGAGGAAGAAATGAAGCAGATG
AATCGTAACTTCTGGGCGTTTGGGAGCGGTGGGAGGATGTGTCTGGGAAGTAACTTTGCCTGGAATAGTACGTCG
GCTCCCACAAGGAAGATGAATGTGCTGACGCAGGACAAGGTATCAACCAAATCACCTACTTGA
Transcript >Ophun1|483
ATGCTGATCCTCCTTCTCGCCGCCTTGGCCGCGGCCTACGGGCTCTATTCATACCTTCTCCTCCCCCTCTTCTTC
TCCCCGCTCTCCCGGCTTCCAACCCCGCACTGGTCCTGCGCTCTTTCAAGTTTCTGGATTCTCCGGGCTCGGAAG
CGGTTCAGCGAGACCAAGACGCTCAGTGATGCCCATTCTCGCCATGGCCCCATCGTCAGGGTCGGCCCCAGAACC
CTCAGCGTCAACAGCGTCGATGCCGTCAGGACCATCTATCAGGGAGGCTTCGACAAGTGGTCGTGGTATTCCGTC
TTCGACTTTTACGGCGTGCACTGCGTCTTCTCCACCCTCGGCTCTCATGAACACGGCCAGAGGAAACGCATCGTC
TCGCGCGTTTACTCCAAGTCATATATCCAGTCGTCGCCTGCCGTCAAAGCCCAGGGCAAGGCTATTCTGCTGGGC
CGACTTCTCCCTCTGCTTCGACGCGAAGCTGTCCATTCAGAGGGTACCGAGATACAGTCCGTCATCTTGTCGACG
ACAATGGACCTCATCTCTGCCTTCAACTTCGGAGTGCAAGCAGGAACTAATTTTGTCCAGGACGTCGAGTACGGC
CGGTATTGGACAGGCCTCTACAGCTACAGATTCCTTCACTTCTTCTGGCCTCAAGAGTTCCCGACCCTGACGTCT
CTGTGCTCCAAGCTCGGGTTCCGGCTTTATCCCTCTTCCGCCGACAAGGTGCACCAAGAAATCGAGGATTGGAAC
AAGCGTATGTGTGACAAGGCTCGAGACGTACTCGATGGAGAAAAGTCGGAGCTCCCTCCTCAGGATGAACCGATC
GTCTTGCGAGCCCTCTACGAAGGCATGGAGAAAGCCCAAGAGCCCAAGGGCGAGAAAGCGGCTCCCAGCAGGACA
TCTATCCAGCACCGACATCTCGAGGTCGCTAGCGAGACGATGGACCACATATTAGCTGGGTTTGAAACCTCTGGC
ATCGCCTTGGTCTTCCTGATTTGGCGGCTGTCCCAGAACCCGGGGCTTCAAGACGAGCTCCGAGCTGAGCTCCTC
ACCGTCAAAGCCCCAACCCCAGACGTCCTCCCCGAGTCCAGAGACTTGGACACCTTACCGCTCCTTCACGCTCTC
GTCATGGAGACGCTTCGACGTCACCCCCCGATCTCTGGTTGCCAGCCGCGCATAACGCCATACCCTTCCAGTAAC
ATCGCCGGTTTCCAAATCCCCGGGGGAGTCCGAATCTCGGCCATGCCCGGCCCTCTACATCTCGACGAGACTGTC
TTTCCGGATCCGCTTCGGTGGGACCACACGAGGTGGCTCCCCGGCGTGAAGTCGGAGGAAGAAATGAAGCAGATG
AATCGTAACTTCTGGGCGTTTGGGAGCGGTGGGAGGATGTGTCTGGGAAGTAACTTTGCCTGGAATAGTACGTCG
GCTCCCACAAGGAAGATGAATGTGCTGACGCAGGACAAGGTATCAACCAAATCACCTACTTGA
Gene >Ophun1|483
ATGCTGATCCTCCTTCTCGCCGCCTTGGCCGCGGCCTACGGGCTCTATTCATACCTTCTCCTCCCCCTCTTCTTC
TCCCCGCTCTCCCGGCTTCCAACCCCGCACTGGTCCTGCGCTCTTTCAAGTTTCTGGATTCTCCGGGCTCGGAAG
CGGTTCAGCGAGACCAAGACGCTCAGTGATGCCCATTCTCGCCATGGCCCCATCGTCAGGGTCGGCCCCAGAACC
CTCAGCGTCAACAGCGTCGATGCCGTCAGGACCATCTATCAGGGAGGCTTCGACAAGTGGTCGTGGTATTCCGTC
TTCGACTTTTACGGCGTGCACTGCGTCTTCTCCACCCTCGGCTCTCATGAACACGGCCAGAGGAAACGCATCGTC
TCGCGCGTTTACTCCAAGTCATATATCCAGTCGTCGCCTGCCGTCAAAGCCCAGGGCAAGGCTATTCTGCTGGGC
CGACTTCTCCCTCTGCTTCGACGCGAAGCTGTCCATTCAGAGGGTACCGAGATACAGTCCGTCATCTTGTCGACG
ACAATGGACCTCATCTCTGCCTTCAACTTCGGAGTGCAAGCAGGAACTAATTTTGTCCAGGACGTCGAGTACGGC
CGGTATTGGACAGGCCTCTACAGCTACAGATTCCTTCACTTCTTCTGGCCTCAAGAGTTCCCGACCCTGACGTCT
CTGTGCTCCAAGCTCGGGTTCCGGCTTTATCCCTCTTCCGCCGACAAGGTGCACCAAGAAATCGAGGATTGGAAC
AAGCGTATGTGTGACAAGGCTCGAGACGTACTCGATGGAGAAAAGTCGGAGCTCCCTCCTCAGGATGAACCGATC
GTCTTGCGAGCCCTCTACGAAGGCATGGAGAAAGCCCAAGAGCCCAAGGGCGAGAAAGCGGCTCCCAGCAGGACA
TCTATCCAGCACCGACATCTCGAGGTCGCTAGCGAGACGATGGACCACATATTAGCTGGGTTTGAAACCTCTGGC
ATCGCCTTGGTCTTCCTGATTTGGCGGCTGTCCCAGAACCCGGGGCTTCAAGACGAGCTCCGAGCTGAGCTCCTC
ACCGTCAAAGCCCCAACCCCAGACGTCCTCCCCGAGTCCAGAGACTTGGACACCTTACCGCTCCTTCACGCTCTC
GTCATGGAGACGCTTCGACGTCACCCCCCGATCTCTGGTTGCCAGCCGCGCATAACGCCATACCCTTCCAGTAAC
ATCGCCGGTTTCCAAATCCCCGGGGGAGTCCGAATCTCGGCCATGCCCGGCCCTCTACATCTCGACGAGACTGTC
TTTCCGGATCCGCTTCGGTGGGACCACACGAGGTGGCTCCCCGGCGTGAAGTCGGAGGAAGAAATGAAGCAGATG
AATCGTAACTTCTGGGCGTTTGGGAGCGGTGGGAGGATGTGTCTGGGAAGTAACTTTGCCTGGAATAGTACGTCG
GCTCCCACAAGGAAGATGAATGTGCTGACGCAGGACAAGGTATCAACCAAATCACCTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail