Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4829
Gene name
LocationContig_455:2500..3820
Strand+
Gene length (bp)1320
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 2.2E-11 1 61

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 154 176 22
2 183 205 22
3 229 251 22
4 264 286 22
5 306 328 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4829
MPACASKCLGPAIAQSSCQVGDQKCLCTDEVLIKKATACIMANCSIKEALHARNSTATSCGEPVRDKSAGYVAVG
EAFGIASSLCVVQRFAYKLWAKLDIGPDDWTTLAAMALSLPTIALDALIVAPNGMGRDTWTLTHDNINTFSRVFF
VMEILYFADVALIKSALVFFYVRIFPAREVRRLLYGTLAVVGVFGLSFVAIAIFQCSPIDYYWWRWDGEHTGRCI
DMNAMAWSNAAISIALDVWMLAIPLWQLRSLKLDWKKKAGVAMMFCVGTFVTVVSILRLRALDFSSHSTNPTWDF
FDVGIWSTVEINVGIMCVCMPSLRLLLMRLIPWLSTSNSRTRTYAQSGLYPKSRPKVGPNQILQSTTYAVEYGDK
EDGDDMRVVYLRDVDVGSLSTAEENVI*
Coding >Ophun1|4829
ATGCCTGCCTGCGCGAGTAAATGCCTGGGGCCTGCTATTGCGCAGTCGAGTTGTCAGGTCGGGGATCAAAAGTGT
CTCTGCACGGACGAGGTGCTCATCAAGAAGGCGACGGCGTGCATCATGGCCAACTGCTCCATCAAGGAGGCTCTT
CACGCGAGAAACTCGACAGCAACCTCGTGCGGCGAGCCCGTCAGAGACAAGTCGGCGGGATACGTGGCGGTGGGC
GAAGCCTTCGGCATAGCCTCCAGCCTCTGCGTCGTCCAGCGCTTCGCCTACAAGCTCTGGGCCAAGCTCGACATC
GGCCCCGACGACTGGACGACGCTGGCAGCCATGGCGCTCAGCCTGCCCACCATTGCCCTCGACGCGCTGATAGTG
GCGCCCAACGGCATGGGCCGCGATACCTGGACGTTGACGCACGACAACATCAACACCTTTAGCCGCGTCTTCTTC
GTCATGGAGATTCTGTACTTTGCCGACGTTGCCCTCATCAAGTCTGCGCTCGTCTTCTTTTACGTTCGCATCTTT
CCGGCCAGGGAGGTTCGAAGGCTGCTGTACGGCACGTTGGCGGTTGTCGGTGTCTTTGGACTCAGTTTCGTCGCC
ATTGCCATCTTTCAGTGCAGTCCCATCGACTACTACTGGTGGCGATGGGACGGGGAGCACACGGGACGGTGCATC
GATATGAACGCCATGGCGTGGTCCAACGCGGCCATTAGCATCGCGCTCGACGTCTGGATGCTGGCGATTCCGCTG
TGGCAGCTGAGGAGCCTGAAGCTGGACTGGAAGAAGAAGGCGGGCGTGGCCATGATGTTCTGCGTGGGAACCTTT
GTCACCGTCGTCAGCATCCTCCGTCTGCGCGCCCTCGACTTCAGCTCGCACTCGACCAATCCGACGTGGGACTTC
TTCGACGTGGGCATCTGGTCGACGGTTGAGATCAACGTGGGCATCATGTGCGTGTGCATGCCATCGCTTCGGCTG
CTGCTGATGCGGCTGATTCCGTGGCTGTCGACGTCGAATTCGAGGACCAGGACGTACGCGCAGTCCGGCTTGTAT
CCCAAGTCGCGGCCCAAGGTCGGGCCCAACCAGATATTGCAGTCGACGACGTATGCGGTCGAGTATGGGGACAAG
GAGGATGGGGATGATATGCGGGTGGTGTATCTTCGGGACGTTGATGTTGGGAGTCTTTCGACGGCGGAGGAGAAT
GTGATTTAG
Transcript >Ophun1|4829
ATGCCTGCCTGCGCGAGTAAATGCCTGGGGCCTGCTATTGCGCAGTCGAGTTGTCAGGTCGGGGATCAAAAGTGT
CTCTGCACGGACGAGGTGCTCATCAAGAAGGCGACGGCGTGCATCATGGCCAACTGCTCCATCAAGGAGGCTCTT
CACGCGAGAAACTCGACAGCAACCTCGTGCGGCGAGCCCGTCAGAGACAAGTCGGCGGGATACGTGGCGGTGGGC
GAAGCCTTCGGCATAGCCTCCAGCCTCTGCGTCGTCCAGCGCTTCGCCTACAAGCTCTGGGCCAAGCTCGACATC
GGCCCCGACGACTGGACGACGCTGGCAGCCATGGCGCTCAGCCTGCCCACCATTGCCCTCGACGCGCTGATAGTG
GCGCCCAACGGCATGGGCCGCGATACCTGGACGTTGACGCACGACAACATCAACACCTTTAGCCGCGTCTTCTTC
GTCATGGAGATTCTGTACTTTGCCGACGTTGCCCTCATCAAGTCTGCGCTCGTCTTCTTTTACGTTCGCATCTTT
CCGGCCAGGGAGGTTCGAAGGCTGCTGTACGGCACGTTGGCGGTTGTCGGTGTCTTTGGACTCAGTTTCGTCGCC
ATTGCCATCTTTCAGTGCAGTCCCATCGACTACTACTGGTGGCGATGGGACGGGGAGCACACGGGACGGTGCATC
GATATGAACGCCATGGCGTGGTCCAACGCGGCCATTAGCATCGCGCTCGACGTCTGGATGCTGGCGATTCCGCTG
TGGCAGCTGAGGAGCCTGAAGCTGGACTGGAAGAAGAAGGCGGGCGTGGCCATGATGTTCTGCGTGGGAACCTTT
GTCACCGTCGTCAGCATCCTCCGTCTGCGCGCCCTCGACTTCAGCTCGCACTCGACCAATCCGACGTGGGACTTC
TTCGACGTGGGCATCTGGTCGACGGTTGAGATCAACGTGGGCATCATGTGCGTGTGCATGCCATCGCTTCGGCTG
CTGCTGATGCGGCTGATTCCGTGGCTGTCGACGTCGAATTCGAGGACCAGGACGTACGCGCAGTCCGGCTTGTAT
CCCAAGTCGCGGCCCAAGGTCGGGCCCAACCAGATATTGCAGTCGACGACGTATGCGGTCGAGTATGGGGACAAG
GAGGATGGGGATGATATGCGGGTGGTGTATCTTCGGGACGTTGATGTTGGGAGTCTTTCGACGGCGGAGGAGAAT
GTGATTTAG
Gene >Ophun1|4829
ATGCCTGCCTGCGCGGTGAGTTGGATCGTGGTTATGGAGTTGGCGTTTTGCTGACGGTGTGGGTGAAGAGTAAAT
GCCTGGGGCCTGCTATTGCGCAGTCGAGTTGTCAGGTCGGGGATCAAAAGTGTCTCTGCACGGACGAGGTGCTCA
TCAAGAAGGCGACGGCGTGCATCATGGCCAACTGCTCCATCAAGGAGGCTCTTCGTGAGTTGCGATGAGAGGGAG
AGGAAGAGAGAGAGAGAGAGAAACTAACAACCATCAGACGCGAGAAACTCGACAGCAACCTCGTGCGGCGAGCCC
GTCAGAGACAAGTCGGCGGGATACGTGGCGGTGGGCGAAGCCTTCGGCATAGCCTCCAGCCTCTGCGTCGTCCAG
CGCTTCGCCTACAAGCTCTGGGCCAAGCTCGACATCGGCCCCGACGACTGGACGACGCTGGCAGCCATGGCGCTC
AGCCTGCCCACCATTGCCCTCGACGCGCTGATAGTGGCGCCCAACGGCATGGGCCGCGATACCTGGACGTTGACG
CACGACAACATCAACACCTTTAGCCGCGTCTTCTTCGTCATGGAGATTCTGTACTTTGCCGACGTTGCCCTCATC
AAGTCTGCGCTCGTCTTCTTTTACGTTCGCATCTTTCCGGCCAGGGAGGTTCGAAGGCTGCTGTACGGCACGTTG
GCGGTTGTCGGTGTCTTTGGACTCAGTTTCGTCGCCATTGCCATCTTTCAGTGCAGTCCCATCGACTACTACTGG
TGGCGATGGGACGGGGAGCACACGGGACGGTGCATCGATATGAACGCCATGGCGTGGTCCAACGCGGCCATTAGC
ATCGCGCTCGACGTCTGGATGCTGGCGATTCCGCTGTGGCAGCTGAGGAGCCTGAAGCTGGACTGGAAGAAGAAG
GCGGGCGTGGCCATGATGTTCTGCGTGGGAACCTTTGTCACCGTCGTCAGCATCCTCCGTCTGCGCGCCCTCGAC
TTCAGCTCGCACTCGACCAATCCGACGTGGGACTTCTTCGACGTGGGCATCTGGTCGACGGTTGAGATCAACGTG
GGCATCATGTGCGTGTGCATGCCATCGCTTCGGCTGCTGCTGATGCGGCTGATTCCGTGGCTGTCGACGTCGAAT
TCGAGGACCAGGACGTACGCGCAGTCCGGCTTGTATCCCAAGTCGCGGCCCAAGGTCGGGCCCAACCAGATATTG
CAGTCGACGACGTATGCGGTCGAGTATGGGGACAAGGAGGATGGGGATGATATGCGGGTGGTGTATCTTCGGGAC
GTTGATGTTGGGAGTCTTTCGACGGCGGAGGAGAATGTGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail