Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4826
Gene name
LocationContig_454:12600..13392
Strand-
Gene length (bp)792
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15985 KH_6 KH domain 2.2E-18 156 210
PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain 7.0E-17 20 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13903|RRP40_SCHPO Exosome complex component rrp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp40 PE=3 SV=1 7 244 7.0E-42
sp|Q08285|RRP40_YEAST Exosome complex component RRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP40 PE=1 SV=2 7 223 1.0E-35
sp|Q7KWX9|EXOS3_DICDI Putative exosome complex component rrp40 OS=Dictyostelium discoideum GN=exosc3 PE=3 SV=1 7 223 1.0E-29
sp|Q7TQK4|EXOS3_MOUSE Exosome complex component RRP40 OS=Mus musculus GN=Exosc3 PE=1 SV=3 21 242 3.0E-26
sp|Q9NQT5|EXOS3_HUMAN Exosome complex component RRP40 OS=Homo sapiens GN=EXOSC3 PE=1 SV=3 29 237 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13903|RRP40_SCHPO Exosome complex component rrp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp40 PE=3 SV=1 7 244 7.0E-42
sp|Q08285|RRP40_YEAST Exosome complex component RRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP40 PE=1 SV=2 7 223 1.0E-35
sp|Q7KWX9|EXOS3_DICDI Putative exosome complex component rrp40 OS=Dictyostelium discoideum GN=exosc3 PE=3 SV=1 7 223 1.0E-29
sp|Q7TQK4|EXOS3_MOUSE Exosome complex component RRP40 OS=Mus musculus GN=Exosc3 PE=1 SV=3 21 242 3.0E-26
sp|Q9NQT5|EXOS3_HUMAN Exosome complex component RRP40 OS=Homo sapiens GN=EXOSC3 PE=1 SV=3 29 237 3.0E-24
sp|Q3T0E1|EXOS3_BOVIN Exosome complex component RRP40 OS=Bos taurus GN=EXOSC3 PE=2 SV=1 29 242 5.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3627
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3114
Ophiocordyceps australis map64 (Brazil) OphauB2|7427
Ophiocordyceps camponoti-floridani Ophcf2|06187
Ophiocordyceps camponoti-rufipedis Ophun1|4826 (this protein)
Ophiocordyceps kimflemingae Ophio5|2005
Ophiocordyceps subramaniannii Hirsu2|7006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4826
MATDPVFVLPGDSIDNSLIPSHPKKQLRLGPGLRHVPPGTILPSLAGRLVTDRRKNAMHVETSAGRYLARTGELV
IGTVLKSTADYYYVLLSDYTAPALLPQLSFEGASRKTRPNLSPGALVYARVSLANKHMDPELECVSATTGKADGL
GPLAGGMLFSISLGMARRLMMPKVAVDGKVVVLDELAALGLQFETATGRNGRFWVDSEDVKTVIAVGRAVQETDE
GRLSVEDQRRLVKRITKKMS*
Coding >Ophun1|4826
ATGGCCACAGACCCGGTCTTCGTCCTTCCGGGCGACAGTATAGACAATTCTCTGATACCCTCGCACCCAAAGAAA
CAGCTACGTCTCGGCCCTGGTCTGCGCCATGTGCCACCCGGGACTATCCTCCCCTCGCTGGCCGGCAGGCTGGTG
ACGGACCGGCGCAAGAACGCCATGCACGTCGAGACGAGCGCCGGACGCTACCTCGCACGAACAGGCGAGCTCGTC
ATCGGCACCGTCCTCAAAAGCACGGCAGATTACTACTACGTCCTCCTCTCCGACTACACCGCCCCAGCACTCCTC
CCCCAGCTCTCATTCGAAGGCGCCTCGCGCAAGACACGACCCAACCTCTCCCCCGGCGCCCTCGTCTACGCCCGC
GTCAGCCTGGCCAACAAGCACATGGACCCTGAACTCGAGTGCGTGTCCGCCACGACGGGGAAAGCCGATGGTCTG
GGGCCGTTGGCTGGCGGCATGCTGTTTTCCATATCGCTCGGTATGGCTAGGAGACTCATGATGCCCAAGGTCGCT
GTGGATGGCAAGGTTGTGGTGCTGGATGAGCTCGCTGCTCTGGGCTTGCAGTTTGAGACGGCGACGGGGAGGAAT
GGTAGGTTCTGGGTTGATAGTGAGGATGTCAAGACGGTCATTGCTGTTGGGAGGGCTGTTCAGGAGACGGATGAG
GGGAGGTTATCGGTAGAGGACCAGAGAAGACTGGTCAAGAGAATCACCAAGAAAATGAGTTGA
Transcript >Ophun1|4826
ATGGCCACAGACCCGGTCTTCGTCCTTCCGGGCGACAGTATAGACAATTCTCTGATACCCTCGCACCCAAAGAAA
CAGCTACGTCTCGGCCCTGGTCTGCGCCATGTGCCACCCGGGACTATCCTCCCCTCGCTGGCCGGCAGGCTGGTG
ACGGACCGGCGCAAGAACGCCATGCACGTCGAGACGAGCGCCGGACGCTACCTCGCACGAACAGGCGAGCTCGTC
ATCGGCACCGTCCTCAAAAGCACGGCAGATTACTACTACGTCCTCCTCTCCGACTACACCGCCCCAGCACTCCTC
CCCCAGCTCTCATTCGAAGGCGCCTCGCGCAAGACACGACCCAACCTCTCCCCCGGCGCCCTCGTCTACGCCCGC
GTCAGCCTGGCCAACAAGCACATGGACCCTGAACTCGAGTGCGTGTCCGCCACGACGGGGAAAGCCGATGGTCTG
GGGCCGTTGGCTGGCGGCATGCTGTTTTCCATATCGCTCGGTATGGCTAGGAGACTCATGATGCCCAAGGTCGCT
GTGGATGGCAAGGTTGTGGTGCTGGATGAGCTCGCTGCTCTGGGCTTGCAGTTTGAGACGGCGACGGGGAGGAAT
GGTAGGTTCTGGGTTGATAGTGAGGATGTCAAGACGGTCATTGCTGTTGGGAGGGCTGTTCAGGAGACGGATGAG
GGGAGGTTATCGGTAGAGGACCAGAGAAGACTGGTCAAGAGAATCACCAAGAAAATGAGTTGA
Gene >Ophun1|4826
ATGGCCACAGACCCGGTCTTCGTCCTTCCGGGCGACAGTATAGACAATTCTCTGATACCCTCGCACCCAAAGAAA
CAGCTACGTCTCGGCCCTGGTCTGCGCCATGTGCCACCCGGGACTATCCTCCCCTCGCTGGCCGGCAGGCTGGTG
ACGGACCGGCGCAAGAACGCCATGCACGTCGAGACGAGCGCCGGACGCGTACATCTCCCTCCCATAACTCTTGCG
GTTCTTACACTAAAGCGGGAATATTAGTACCTCGCACGAACAGGCGAGCTCGTCATCGGCACCGTCCTCAAAAGC
ACGGCAGATTACTACTACGTCCTCCTCTCCGACTACACCGCCCCAGCACTCCTCCCCCAGCTCTCATTCGAAGGC
GCCTCGCGCAAGACACGACCCAACCTCTCCCCCGGCGCCCTCGTCTACGCCCGCGTCAGCCTGGCCAACAAGCAC
ATGGACCCTGAACTCGAGTGCGTGTCCGCCACGACGGGGAAAGCCGATGGTCTGGGGCCGTTGGCTGGCGGCATG
CTGTTTTCCATATCGCTCGGTATGGCTAGGAGACTCATGATGCCCAAGGTCGCTGTGGATGGCAAGGTTGTGGTG
CTGGATGAGCTCGCTGCTCTGGGCTTGCAGTTTGAGACGGCGACGGGGAGGAATGGTAGGTTCTGGGTTGATAGT
GAGGATGTCAAGACGGTCATTGCTGTTGGGAGGGCTGTTCAGGAGACGGATGAGGGGAGGTTATCGGTAGAGGAC
CAGAGAAGACTGGTCAAGAGAATCACCAAGAAAATGAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail