Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4823
Gene name
LocationContig_454:5481..6621
Strand+
Gene length (bp)1140
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00145 DNA_methylase C-5 cytosine-specific DNA methylase 5.2E-20 49 216
PF00145 DNA_methylase C-5 cytosine-specific DNA methylase 3.4E-10 276 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59606|MTF7_NEIGO Modification methylase NgoFVII OS=Neisseria gonorrhoeae GN=ngoFVIIM PE=3 SV=1 35 338 1.0E-19
sp|P50192|MTHA_HAEPH Modification methylase HphIA OS=Haemophilus parahaemolyticus GN=hphIAM PE=3 SV=1 49 328 1.0E-18
sp|P31033|MTM4_NEIGO Modification methylase NgoMIV OS=Neisseria gonorrhoeae GN=ngoMIVM PE=3 SV=1 47 346 1.0E-17
sp|P52311|MTX2_XANOR Modification methylase XorII OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=xorIIM PE=3 SV=2 51 234 4.0E-16
sp|P94147|MTA1_THAGE Modification methylase AgeI OS=Thalassobius gelatinovorus GN=ageIM PE=3 SV=1 51 297 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59606|MTF7_NEIGO Modification methylase NgoFVII OS=Neisseria gonorrhoeae GN=ngoFVIIM PE=3 SV=1 35 338 1.0E-19
sp|P50192|MTHA_HAEPH Modification methylase HphIA OS=Haemophilus parahaemolyticus GN=hphIAM PE=3 SV=1 49 328 1.0E-18
sp|P31033|MTM4_NEIGO Modification methylase NgoMIV OS=Neisseria gonorrhoeae GN=ngoMIVM PE=3 SV=1 47 346 1.0E-17
sp|P52311|MTX2_XANOR Modification methylase XorII OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=xorIIM PE=3 SV=2 51 234 4.0E-16
sp|P94147|MTA1_THAGE Modification methylase AgeI OS=Thalassobius gelatinovorus GN=ageIM PE=3 SV=1 51 297 2.0E-13
sp|P08455|MTP2_NEIGO Modification methylase NgoPII OS=Neisseria gonorrhoeae GN=ngoPIIM PE=3 SV=2 54 344 2.0E-13
sp|P09795|MTS1_SALIN Modification methylase SinI OS=Salmonella infantis GN=sinIM PE=3 SV=1 41 327 2.0E-13
sp|P34906|MTF1_FUSNU Modification methylase FnuDI OS=Fusobacterium nucleatum GN=fnuDIM PE=3 SV=1 50 348 3.0E-13
sp|P13864|DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus GN=Dnmt1 PE=1 SV=5 51 226 6.0E-13
sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens GN=DNMT1 PE=1 SV=2 51 226 2.0E-12
sp|Q27746|DNMT1_PARLI DNA (cytosine-5)-methyltransferase PliMCI OS=Paracentrotus lividus GN=DNMT PE=2 SV=1 44 226 2.0E-12
sp|P29567|MTHT_METTF Modification methylase MthTI OS=Methanothermobacter thermautotrophicus GN=mthTIM PE=1 SV=1 54 342 7.0E-12
sp|P50188|MTN1_NOCAE Modification methylase NaeI OS=Lechevalieria aerocolonigenes GN=naeIM PE=3 SV=1 55 345 8.0E-12
sp|Q9Z330|DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus GN=Dnmt1 PE=1 SV=2 51 226 1.0E-11
sp|Q24K09|DNMT1_BOVIN DNA (cytosine-5)-methyltransferase 1 OS=Bos taurus GN=DNMT1 PE=2 SV=1 51 226 1.0E-11
sp|Q92072|DNMT1_CHICK DNA (cytosine-5)-methyltransferase 1 OS=Gallus gallus GN=DNMT1 PE=1 SV=1 51 226 1.0E-11
sp|P45000|MTH5_HAEIN Modification methylase HindV OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hindVM PE=3 SV=1 52 334 6.0E-11
sp|O52702|MTA1_ACEPA Modification methylase ApaLI OS=Acetobacter pasteurianus GN=apaLIM PE=3 SV=1 54 271 7.0E-11
sp|P23737|MTS9_STAAU Modification methylase Sau96I OS=Staphylococcus aureus GN=sau96IM PE=3 SV=1 48 338 4.0E-10
sp|P25264|MTC2_HERAU Modification methylase HgiCII OS=Herpetosiphon aurantiacus GN=hgiCIIM PE=3 SV=1 47 229 4.0E-10
sp|P50196|MTE8_ECOLX Modification methylase Eco47II OS=Escherichia coli GN=eco47IIM PE=3 SV=1 48 212 1.0E-09
sp|P24600|MTD1_HERAU Modification methylase HgiDI OS=Herpetosiphon aurantiacus GN=hgiDIM PE=3 SV=1 51 350 4.0E-09
sp|P25262|MTB1_HERAU Modification methylase HgiBI OS=Herpetosiphon aurantiacus GN=hgiBIM PE=3 SV=1 46 228 1.0E-08
sp|Q7Y1I7|DNM1A_ORYSJ DNA (cytosine-5)-methyltransferase 1A OS=Oryza sativa subsp. japonica GN=MET1A PE=2 SV=1 286 342 2.0E-07
sp|Q9T0I1|DNMT3_ARATH DNA (cytosine-5)-methyltransferase 3 OS=Arabidopsis thaliana GN=MET3 PE=3 SV=1 286 342 2.0E-07
sp|P13864|DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus GN=Dnmt1 PE=1 SV=5 287 343 3.0E-07
sp|Q24K09|DNMT1_BOVIN DNA (cytosine-5)-methyltransferase 1 OS=Bos taurus GN=DNMT1 PE=2 SV=1 287 343 8.0E-07
sp|O52702|MTA1_ACEPA Modification methylase ApaLI OS=Acetobacter pasteurianus GN=apaLIM PE=3 SV=1 269 339 8.0E-07
sp|P34883|MTAB_SYNP2 Modification methylase AquI subunit beta OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=aquIMB PE=3 SV=1 269 343 2.0E-06
sp|B1Q3J6|DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B OS=Oryza sativa subsp. japonica GN=MET1B PE=2 SV=1 286 342 2.0E-06
sp|Q9Z330|DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus GN=Dnmt1 PE=1 SV=2 287 343 2.0E-06
sp|P34881|DNMT1_ARATH DNA (cytosine-5)-methyltransferase 1 OS=Arabidopsis thaliana GN=DMT1 PE=1 SV=1 286 342 2.0E-06
sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens GN=DNMT1 PE=1 SV=2 287 343 3.0E-06
sp|Q92072|DNMT1_CHICK DNA (cytosine-5)-methyltransferase 1 OS=Gallus gallus GN=DNMT1 PE=1 SV=1 287 346 4.0E-06
sp|Q27746|DNMT1_PARLI DNA (cytosine-5)-methyltransferase PliMCI OS=Paracentrotus lividus GN=DNMT PE=2 SV=1 287 342 5.0E-06
sp|O33481|MTP1_PSYTA Modification methylase PspPI OS=Psychrobacter sp. (strain TA137) GN=pspPIM PE=3 SV=1 41 210 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3625
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4009
Ophiocordyceps australis map64 (Brazil) OphauB2|7397
Ophiocordyceps camponoti-floridani Ophcf2|06190
Ophiocordyceps camponoti-rufipedis Ophun1|4823 (this protein)
Ophiocordyceps kimflemingae Ophio5|1998
Ophiocordyceps subramaniannii Hirsu2|7003

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4823
MKINEVALSRMRSSDCSQVGYRVPESKLREEWRGSQAVRQAPNPFHRYTLFDAFCGAGGVSRGADMAGFDVTHAM
DMSDRACQTYRLNFPKARLYRMPVHDFIVSPGHIRTDVLHLSPPCQPYSPAHTHESIHDDENKDAFLGSCHLIDK
IRPRLVTLEETFGLGFDRHIPYLRALISHLTCRGYSLRWRPRLRLCTWGCAQDRKRLVMIAAGPGEKLPSFPRAT
HSETGGGGLKPFTSFGQAIKGISSRDEHHNLRALGTFPEPKTPLDANQLAKTMTTSGSEPYHPSGKRMLSVRERA
CLQGFPHHHRFVGNGRDICRQIGNAFPPNTVKVLYRHLKKCLMREDGLLPMAVGVEDHEGVIRIEDDLPVPGRLV
IDLT*
Coding >Ophun1|4823
ATGAAGATCAACGAGGTGGCTTTATCGCGAATGAGGTCCTCGGACTGCTCTCAAGTCGGCTACCGAGTTCCAGAG
TCGAAGCTGCGAGAGGAGTGGCGAGGATCTCAGGCAGTCCGGCAGGCACCGAACCCGTTCCACAGGTATACGCTG
TTTGACGCCTTTTGCGGTGCTGGCGGCGTCTCGCGAGGAGCAGACATGGCAGGTTTCGACGTGACTCATGCCATG
GACATGAGCGATAGGGCCTGCCAGACCTACAGGCTCAACTTTCCCAAAGCTCGACTCTACCGGATGCCGGTTCAC
GACTTCATCGTGTCGCCTGGGCATATTCGTACCGACGTGCTGCATCTGTCACCTCCGTGTCAGCCCTATTCGCCT
GCCCACACCCACGAGTCGATCCACGATGACGAGAACAAGGACGCCTTCCTCGGAAGTTGCCATCTCATCGATAAG
ATCCGCCCTCGCCTGGTAACGCTTGAGGAGACGTTCGGCCTTGGCTTCGACAGGCACATTCCTTATCTGCGAGCT
TTGATCAGCCACCTGACCTGTCGCGGGTATTCCCTTCGCTGGAGGCCGCGGCTTAGGCTGTGCACCTGGGGCTGC
GCTCAGGATCGGAAACGGCTCGTCATGATCGCTGCCGGCCCAGGAGAAAAGCTCCCGTCTTTTCCCAGAGCTACC
CATTCGGAAACGGGTGGCGGAGGCCTCAAACCATTTACGTCTTTCGGCCAGGCCATTAAGGGCATATCGTCTCGC
GACGAACATCATAACCTCAGAGCCCTGGGAACCTTCCCAGAGCCCAAGACGCCCCTCGATGCCAATCAACTAGCA
AAGACAATGACAACATCGGGCTCTGAACCGTATCATCCTAGTGGAAAACGCATGCTCTCGGTTCGGGAGCGCGCC
TGCCTGCAGGGGTTCCCGCACCATCACCGGTTTGTCGGGAACGGGAGGGACATCTGCCGCCAGATCGGCAATGCC
TTCCCACCCAATACGGTGAAGGTCTTGTATAGACATCTAAAGAAGTGTCTCATGAGGGAAGACGGTTTGTTGCCC
ATGGCAGTCGGCGTCGAGGATCATGAGGGAGTCATCCGGATCGAGGACGACCTGCCGGTGCCTGGAAGACTGGTG
ATCGACTTGACCTGA
Transcript >Ophun1|4823
ATGAAGATCAACGAGGTGGCTTTATCGCGAATGAGGTCCTCGGACTGCTCTCAAGTCGGCTACCGAGTTCCAGAG
TCGAAGCTGCGAGAGGAGTGGCGAGGATCTCAGGCAGTCCGGCAGGCACCGAACCCGTTCCACAGGTATACGCTG
TTTGACGCCTTTTGCGGTGCTGGCGGCGTCTCGCGAGGAGCAGACATGGCAGGTTTCGACGTGACTCATGCCATG
GACATGAGCGATAGGGCCTGCCAGACCTACAGGCTCAACTTTCCCAAAGCTCGACTCTACCGGATGCCGGTTCAC
GACTTCATCGTGTCGCCTGGGCATATTCGTACCGACGTGCTGCATCTGTCACCTCCGTGTCAGCCCTATTCGCCT
GCCCACACCCACGAGTCGATCCACGATGACGAGAACAAGGACGCCTTCCTCGGAAGTTGCCATCTCATCGATAAG
ATCCGCCCTCGCCTGGTAACGCTTGAGGAGACGTTCGGCCTTGGCTTCGACAGGCACATTCCTTATCTGCGAGCT
TTGATCAGCCACCTGACCTGTCGCGGGTATTCCCTTCGCTGGAGGCCGCGGCTTAGGCTGTGCACCTGGGGCTGC
GCTCAGGATCGGAAACGGCTCGTCATGATCGCTGCCGGCCCAGGAGAAAAGCTCCCGTCTTTTCCCAGAGCTACC
CATTCGGAAACGGGTGGCGGAGGCCTCAAACCATTTACGTCTTTCGGCCAGGCCATTAAGGGCATATCGTCTCGC
GACGAACATCATAACCTCAGAGCCCTGGGAACCTTCCCAGAGCCCAAGACGCCCCTCGATGCCAATCAACTAGCA
AAGACAATGACAACATCGGGCTCTGAACCGTATCATCCTAGTGGAAAACGCATGCTCTCGGTTCGGGAGCGCGCC
TGCCTGCAGGGGTTCCCGCACCATCACCGGTTTGTCGGGAACGGGAGGGACATCTGCCGCCAGATCGGCAATGCC
TTCCCACCCAATACGGTGAAGGTCTTGTATAGACATCTAAAGAAGTGTCTCATGAGGGAAGACGGTTTGTTGCCC
ATGGCAGTCGGCGTCGAGGATCATGAGGGAGTCATCCGGATCGAGGACGACCTGCCGGTGCCTGGAAGACTGGTG
ATCGACTTGACCTGA
Gene >Ophun1|4823
ATGAAGATCAACGAGGTGGCTTTATCGCGAATGAGGTCCTCGGACTGCTCTCAAGTCGGCTACCGAGTTCCAGAG
TCGAAGCTGCGAGAGGAGTGGCGAGGATCTCAGGCAGTCCGGCAGGCACCGAACCCGTTCCACAGGTATACGCTG
TTTGACGCCTTTTGCGGTGCTGGCGGCGTCTCGCGAGGAGCAGACATGGCAGGTTTCGACGTGACTCATGCCATG
GACATGAGCGATAGGGCCTGCCAGACCTACAGGCTCAACTTTCCCAAAGCTCGACTCTACCGGATGCCGGTTCAC
GACTTCATCGTGTCGCCTGGGCATATTCGTACCGACGTGCTGCATCTGTCACCTCCGTGTCAGCCCTATTCGCCT
GCCCACACCCACGAGTCGATCCACGATGACGAGAACAAGGACGCCTTCCTCGGAAGTTGCCATCTCATCGATAAG
ATCCGCCCTCGCCTGGTAACGCTTGAGGAGACGTTCGGCCTTGGCTTCGACAGGCACATTCCTTATCTGCGAGCT
TTGATCAGCCACCTGACCTGTCGCGGGTATTCCCTTCGCTGGAGGCCGCGGCTTAGGCTGTGCACCTGGGGCTGC
GCTCAGGATCGGAAACGGCTCGTCATGATCGCTGCCGGCCCAGGAGAAAAGCTCCCGTCTTTTCCCAGAGCTACC
CATTCGGAAACGGGTGGCGGAGGCCTCAAACCATTTACGTCTTTCGGCCAGGCCATTAAGGGCATATCGTCTCGC
GACGAACATCATAACCTCAGAGCCCTGGGAACCTTCCCAGAGCCCAAGACGCCCCTCGATGCCAATCAACTAGCA
AAGACAATGACAACATCGGGCTCTGAACCGTATCATCCTAGTGGAAAACGCATGCTCTCGGTTCGGGAGCGCGCC
TGCCTGCAGGGGTTCCCGCACCATCACCGGTTTGTCGGGAACGGGAGGGACATCTGCCGCCAGATCGGCAATGCC
TTCCCACCCAATACGGTGAAGGTCTTGTATAGACATCTAAAGAAGTGTCTCATGAGGGAAGACGGTTTGTTGCCC
ATGGCAGTCGGCGTCGAGGATCATGAGGGAGTCATCCGGATCGAGGACGACCTGCCGGTGCCTGGAAGACTGGTG
ATCGACTTGACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail