Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|482
Gene name
LocationContig_114:2976..4768
Strand-
Gene length (bp)1792
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 6.3E-80 198 517

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8E9|PNS1_GIBZE Protein PNS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNS1 PE=3 SV=1 69 544 0.0E+00
sp|Q4WYG7|PNS1_ASPFU Protein pns1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pns1 PE=3 SV=1 32 541 7.0E-178
sp|Q870V7|PNS1_NEUCR Protein PNS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pns-1 PE=3 SV=1 19 543 7.0E-173
sp|Q6C938|PNS1_YARLI Protein PNS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNS1 PE=3 SV=1 10 541 4.0E-122
sp|Q6CY85|PNS1_KLULA Protein PNS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PNS1 PE=3 SV=1 44 541 2.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8E9|PNS1_GIBZE Protein PNS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNS1 PE=3 SV=1 69 544 0.0E+00
sp|Q4WYG7|PNS1_ASPFU Protein pns1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pns1 PE=3 SV=1 32 541 7.0E-178
sp|Q870V7|PNS1_NEUCR Protein PNS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pns-1 PE=3 SV=1 19 543 7.0E-173
sp|Q6C938|PNS1_YARLI Protein PNS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNS1 PE=3 SV=1 10 541 4.0E-122
sp|Q6CY85|PNS1_KLULA Protein PNS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PNS1 PE=3 SV=1 44 541 2.0E-100
sp|Q12412|PNS1_YEAST Protein PNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNS1 PE=1 SV=1 43 541 8.0E-100
sp|Q6BIV4|PNS1_DEBHA Protein PNS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PNS1 PE=3 SV=2 60 543 1.0E-99
sp|Q75EG5|PNS1_ASHGO Protein PNS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PNS1 PE=3 SV=1 21 541 6.0E-93
sp|Q5AB93|PNS1_CANAL Protein PNS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PNS1 PE=3 SV=1 28 541 2.0E-89
sp|Q6FLC9|PNS1_CANGA Protein PNS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PNS1 PE=3 SV=1 19 541 2.0E-88
sp|Q4PIP8|PNS1_USTMA Protein PNS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PNS1 PE=3 SV=2 38 541 2.0E-86
sp|P0CM93|PNS1_CRYNB Protein PNS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PNS1 PE=3 SV=1 43 541 3.0E-83
sp|P0CM92|PNS1_CRYNJ Protein PNS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PNS1 PE=3 SV=1 43 541 3.0E-83
sp|Q869R1|CTLHB_DICDI CTL-like protein DDB_G0274487 OS=Dictyostelium discoideum GN=DDB_G0274487 PE=3 SV=1 79 528 6.0E-40
sp|Q54IJ2|CTLHA_DICDI CTL-like protein DDB_G0288717 OS=Dictyostelium discoideum GN=DDB_G0288717 PE=3 SV=1 257 539 9.0E-18
sp|Q55CN8|CTLHC_DICDI CTL-like protein DDB_G0269978 OS=Dictyostelium discoideum GN=DDB_G0269978 PE=3 SV=1 96 534 3.0E-15
sp|A8XKF2|CTL1L_CAEBR Choline transporter-like protein 1 OS=Caenorhabditis briggsae GN=chtl-1 PE=3 SV=2 278 462 3.0E-13
sp|A5D7H3|CTL2_BOVIN Choline transporter-like protein 2 OS=Bos taurus GN=SLC44A2 PE=2 SV=1 266 511 3.0E-13
sp|Q20026|CTL1L_CAEEL Choline transporter-like protein 1 OS=Caenorhabditis elegans GN=chtl-1 PE=3 SV=1 278 462 1.0E-12
sp|Q810F1|CTL2_CAVPO Choline transporter-like protein 2 OS=Cavia porcellus GN=SLC44A2 PE=1 SV=1 269 511 7.0E-12
sp|B4F795|CTL2_RAT Choline transporter-like protein 2 OS=Rattus norvegicus GN=Slc44a2 PE=2 SV=1 269 511 9.0E-12
sp|F1S584|CTL2_PIG Choline transporter-like protein 2 OS=Sus scrofa GN=SLC44A2 PE=3 SV=1 269 511 9.0E-12
sp|Q5R5L9|CTL2_PONAB Choline transporter-like protein 2 OS=Pongo abelii GN=SLC44A2 PE=2 SV=1 269 517 1.0E-11
sp|Q53GD3|CTL4_HUMAN Choline transporter-like protein 4 OS=Homo sapiens GN=SLC44A4 PE=2 SV=2 285 511 1.0E-11
sp|Q95JW2|CTL5_MACFA Choline transporter-like protein 5 OS=Macaca fascicularis GN=SLC44A5 PE=2 SV=1 291 464 2.0E-11
sp|Q8IWA5|CTL2_HUMAN Choline transporter-like protein 2 OS=Homo sapiens GN=SLC44A2 PE=1 SV=3 269 511 2.0E-11
sp|Q6IP59|CTL2_XENLA Choline transporter-like protein 2 OS=Xenopus laevis GN=slc44a2 PE=2 SV=1 103 511 2.0E-11
sp|Q8BY89|CTL2_MOUSE Choline transporter-like protein 2 OS=Mus musculus GN=Slc44a2 PE=1 SV=2 269 517 3.0E-11
sp|A3KMY4|CTL4_BOVIN Choline transporter-like protein 4 OS=Bos taurus GN=SLC44A4 PE=2 SV=1 277 511 5.0E-11
sp|Q8NCS7|CTL5_HUMAN Choline transporter-like protein 5 OS=Homo sapiens GN=SLC44A5 PE=2 SV=4 291 464 5.0E-11
sp|A5PF08|CTL4_PIG Choline transporter-like protein 4 OS=Sus scrofa GN=SLC44A4 PE=3 SV=1 285 511 6.0E-11
sp|Q5RJI2|CTL5_MOUSE Choline transporter-like protein 5 OS=Mus musculus GN=Slc44a5 PE=2 SV=1 269 511 7.0E-11
sp|A5PMW0|CTL5A_DANRE Choline transporter-like protein 5-A (Fragment) OS=Danio rerio GN=slc44a5a PE=3 SV=1 303 517 8.0E-11
sp|Q91VA1|CTL4_MOUSE Choline transporter-like protein 4 OS=Mus musculus GN=Slc44a4 PE=1 SV=1 285 511 1.0E-10
sp|Q7T2B0|CTL4_DANRE Choline transporter-like protein 4 OS=Danio rerio GN=slc44a4 PE=2 SV=1 285 511 1.0E-10
sp|B5X3W7|CTL2_SALSA Choline transporter-like protein 2 OS=Salmo salar GN=slc44a2 PE=2 SV=1 269 529 2.0E-10
sp|B0JZD0|CTL5_XENTR Choline transporter-like protein 5 OS=Xenopus tropicalis GN=slc44a5 PE=2 SV=1 295 517 6.0E-10
sp|Q6MG71|CTL4_RAT Choline transporter-like protein 4 OS=Rattus norvegicus GN=Slc44a4 PE=2 SV=1 285 428 1.0E-09
sp|Q7SYC9|CTL2_DANRE Choline transporter-like protein 2 OS=Danio rerio GN=slc44a2 PE=2 SV=1 286 540 2.0E-09
sp|Q6GN42|CTL4_XENLA Choline transporter-like protein 4 OS=Xenopus laevis GN=slc44a4 PE=2 SV=1 267 511 2.0E-09
sp|B0S5A7|CTL5B_DANRE Choline transporter-like protein 5-B (Fragment) OS=Danio rerio GN=slc44a5b PE=3 SV=1 303 517 3.0E-09
sp|Q7Q5R7|CTLH1_ANOGA CTL-like protein 1 OS=Anopheles gambiae GN=AGAP006244 PE=3 SV=4 248 518 3.0E-08
sp|Q54I48|CTL2_DICDI Choline transporter-like protein 2 OS=Dictyostelium discoideum GN=slc44a2 PE=3 SV=1 291 517 6.0E-08
sp|Q7PRJ0|CTLH2_ANOGA CTL-like protein 2 OS=Anopheles gambiae GN=AGAP010343 PE=3 SV=4 331 511 1.0E-07
sp|Q9VAP3|CTLH2_DROME CTL-like protein 2 OS=Drosophila melanogaster GN=CG11880 PE=3 SV=1 290 511 1.0E-07
sp|Q17JQ7|CTLH1_AEDAE CTL-like protein 1 OS=Aedes aegypti GN=AAEL001935 PE=3 SV=1 297 518 1.0E-07
sp|Q9I9B9|CTL1_TORMA Choline transporter-like protein 1 OS=Torpedo marmorata GN=slc44a1 PE=1 SV=1 291 517 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 103 125 22
2 140 162 22
3 169 191 22
4 196 215 19
5 236 258 22
6 337 359 22
7 379 401 22
8 442 464 22
9 477 499 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|482
MNKADGYAGQQQQQQYGQPQYGQQQHPQQQYGQQSYYYGGSNHDGQQPYPPQDPYGPPHDAYNQPQPSYAPPPPY
SFNPPQPNDDKYSFEQAFKIDRPKYNDLWAGILFLVVFAGYVVISAISIRGWSTRGGSGVVSRNTVALFGWVVLA
ALILSYGYVWMARLFPKQFIWVTGILNLCFLYATAVYYLYIRSYGPGIIFLIMAVFTTFAALTWIKRIPFSALML
KTSVDVARKYGHVYLVSLLGGILGVILAAWYGVTVTAIYVRFRPDDNCSSAQGKNCSSGTVIGLIVYATFAMYWT
SEWLKNTVHTTVSGVYGSWYFCPHNFPKAATRGAMKRALTYSFGSISLGSLLVAIVNMLRQICSIAGQQAANDGG
VMDVVFYVISLIVGCLLSLLQWAIEFVNRYAFSYIALYGKAYFPAAKDTWTMIRDRGIDALVNECLIGPVLSFGA
IFIGAVCTLLAFLFVRISHSQLQSNNGYLAAVMAFAFLVGFQIANIFTTPISSGIDTIFVASGWDPQVMYSEHPE
LYQDMVRVYPQVQQAIIAR*
Coding >Ophun1|482
ATGAACAAGGCCGACGGTTACGCTGGCCAGCAGCAGCAGCAGCAGTACGGCCAGCCGCAGTACGGACAGCAGCAG
CACCCGCAGCAGCAGTATGGCCAGCAGAGCTACTACTACGGCGGCTCCAACCACGACGGCCAGCAGCCATATCCT
CCCCAGGACCCCTACGGCCCTCCGCACGACGCCTACAACCAGCCACAGCCGTCGTACGCGCCACCTCCGCCCTAC
AGTTTCAACCCGCCGCAGCCCAACGACGACAAATACTCGTTCGAGCAGGCCTTCAAGATCGACCGTCCCAAGTAC
AACGACCTCTGGGCTGGTATTCTCTTTCTCGTCGTCTTTGCTGGCTACGTCGTCATCTCTGCCATTTCCATCCGA
GGATGGTCCACCAGAGGCGGCAGCGGCGTCGTCAGCCGCAACACCGTCGCTCTCTTCGGCTGGGTTGTGCTCGCC
GCGCTGATCCTCTCGTACGGCTACGTCTGGATGGCCCGTCTCTTCCCTAAGCAGTTCATCTGGGTCACCGGCATC
CTCAACCTCTGCTTCCTCTATGCGACGGCCGTATACTATCTGTATATCCGGAGCTATGGTCCCGGCATCATCTTC
CTCATCATGGCCGTCTTCACCACCTTTGCGGCCCTTACGTGGATCAAACGCATACCCTTCTCGGCCTTGATGCTC
AAGACGTCTGTCGACGTTGCCCGCAAATACGGCCACGTCTATCTCGTCAGCCTGCTCGGCGGCATCCTGGGCGTC
ATCCTGGCTGCGTGGTACGGCGTCACGGTGACGGCCATCTACGTCCGCTTCCGACCCGATGACAACTGCAGCAGC
GCCCAGGGCAAGAACTGCAGCAGCGGCACCGTCATCGGCCTCATTGTCTATGCCACCTTTGCCATGTACTGGACG
TCCGAGTGGCTGAAGAACACGGTTCACACGACCGTGTCTGGCGTCTACGGCTCGTGGTACTTTTGCCCTCACAAC
TTTCCCAAGGCCGCCACCCGCGGCGCCATGAAGCGCGCCCTCACCTACAGCTTTGGCTCCATCAGTCTTGGGAGC
TTGCTGGTGGCCATTGTCAACATGTTGCGCCAGATCTGTTCCATCGCCGGTCAACAGGCTGCTAACGACGGCGGG
GTTATGGATGTCGTCTTCTATGTCATCTCCTTGATCGTCGGCTGCCTTCTCTCGCTTCTCCAGTGGGCCATCGAG
TTTGTCAACCGCTACGCCTTCTCGTACATTGCGCTGTATGGCAAGGCCTATTTCCCGGCGGCCAAGGACACGTGG
ACCATGATCCGGGATCGCGGCATCGACGCCCTGGTCAACGAATGCCTCATCGGGCCCGTGCTCTCGTTCGGGGCC
ATATTCATAGGCGCCGTCTGCACCCTGCTCGCCTTTCTCTTTGTCCGAATCAGCCACTCGCAGCTGCAGTCCAAC
AACGGCTACTTGGCGGCCGTCATGGCCTTTGCCTTTCTCGTCGGCTTCCAGATCGCCAACATCTTTACGACGCCG
ATTTCGAGCGGCATCGACACCATCTTTGTCGCCTCGGGTTGGGATCCTCAGGTCATGTACAGCGAGCACCCGGAG
CTGTATCAGGACATGGTGCGCGTGTATCCGCAGGTGCAGCAGGCCATCATTGCCCGTTGA
Transcript >Ophun1|482
ATGAACAAGGCCGACGGTTACGCTGGCCAGCAGCAGCAGCAGCAGTACGGCCAGCCGCAGTACGGACAGCAGCAG
CACCCGCAGCAGCAGTATGGCCAGCAGAGCTACTACTACGGCGGCTCCAACCACGACGGCCAGCAGCCATATCCT
CCCCAGGACCCCTACGGCCCTCCGCACGACGCCTACAACCAGCCACAGCCGTCGTACGCGCCACCTCCGCCCTAC
AGTTTCAACCCGCCGCAGCCCAACGACGACAAATACTCGTTCGAGCAGGCCTTCAAGATCGACCGTCCCAAGTAC
AACGACCTCTGGGCTGGTATTCTCTTTCTCGTCGTCTTTGCTGGCTACGTCGTCATCTCTGCCATTTCCATCCGA
GGATGGTCCACCAGAGGCGGCAGCGGCGTCGTCAGCCGCAACACCGTCGCTCTCTTCGGCTGGGTTGTGCTCGCC
GCGCTGATCCTCTCGTACGGCTACGTCTGGATGGCCCGTCTCTTCCCTAAGCAGTTCATCTGGGTCACCGGCATC
CTCAACCTCTGCTTCCTCTATGCGACGGCCGTATACTATCTGTATATCCGGAGCTATGGTCCCGGCATCATCTTC
CTCATCATGGCCGTCTTCACCACCTTTGCGGCCCTTACGTGGATCAAACGCATACCCTTCTCGGCCTTGATGCTC
AAGACGTCTGTCGACGTTGCCCGCAAATACGGCCACGTCTATCTCGTCAGCCTGCTCGGCGGCATCCTGGGCGTC
ATCCTGGCTGCGTGGTACGGCGTCACGGTGACGGCCATCTACGTCCGCTTCCGACCCGATGACAACTGCAGCAGC
GCCCAGGGCAAGAACTGCAGCAGCGGCACCGTCATCGGCCTCATTGTCTATGCCACCTTTGCCATGTACTGGACG
TCCGAGTGGCTGAAGAACACGGTTCACACGACCGTGTCTGGCGTCTACGGCTCGTGGTACTTTTGCCCTCACAAC
TTTCCCAAGGCCGCCACCCGCGGCGCCATGAAGCGCGCCCTCACCTACAGCTTTGGCTCCATCAGTCTTGGGAGC
TTGCTGGTGGCCATTGTCAACATGTTGCGCCAGATCTGTTCCATCGCCGGTCAACAGGCTGCTAACGACGGCGGG
GTTATGGATGTCGTCTTCTATGTCATCTCCTTGATCGTCGGCTGCCTTCTCTCGCTTCTCCAGTGGGCCATCGAG
TTTGTCAACCGCTACGCCTTCTCGTACATTGCGCTGTATGGCAAGGCCTATTTCCCGGCGGCCAAGGACACGTGG
ACCATGATCCGGGATCGCGGCATCGACGCCCTGGTCAACGAATGCCTCATCGGGCCCGTGCTCTCGTTCGGGGCC
ATATTCATAGGCGCCGTCTGCACCCTGCTCGCCTTTCTCTTTGTCCGAATCAGCCACTCGCAGCTGCAGTCCAAC
AACGGCTACTTGGCGGCCGTCATGGCCTTTGCCTTTCTCGTCGGCTTCCAGATCGCCAACATCTTTACGACGCCG
ATTTCGAGCGGCATCGACACCATCTTTGTCGCCTCGGGTTGGGATCCTCAGGTCATGTACAGCGAGCACCCGGAG
CTGTATCAGGACATGGTGCGCGTGTATCCGCAGGTGCAGCAGGCCATCATTGCCCGTTGA
Gene >Ophun1|482
ATGAACAAGGCCGACGGTTACGCTGGCCAGCAGCAGCAGCAGCAGTACGGCCAGCCGCAGTACGGACAGCAGCAG
CACCCGCAGCAGCAGTATGGCCAGCAGAGCTACTACTACGGCGGCTCCAACCACGACGGCCAGCAGCCATATCCT
CCCCAGGACCCCTACGGCCCTCCGCACGACGCCTACAACCAGCCACAGCCGTCGTACGCGCCACCTCCGCCCTAC
AGTTTCAACCCGCCGCAGCCCAACGACGACAAATACTCGTTCGAGCAGGCCTTCAAGATCGACCGTCCCAAGTAC
AACGACCTCTGGGCTGGTATTCTCGTCTGTGTTTGCGCCCTCCCCTTTGCTGTGACTCGACTGACTCGTGCCTCA
GTTTCTCGTCGTCTTTGCTGGCTACGTCGTCATCTCTGCCATTTCCATCCGAGGATGGTCCACCAGAGGCGGCAG
CGGCGTCGTCAGCCGCAACACCGTCGCTCTCTTCGGCTGGGTTGTGCTCGCCGCGCTGATCCTCTCGTACGGCTA
CGTCTGGATGGCCCGTCTCTTCCCTAAGCAGTTCATCTGGGTCACCGGCATCCTCAACCTCTGCTTCCTCTATGC
GACGGCCGTATACTATCTGTATATCCGGAGCTATGGTCCCGGCATCATCTTCCTCATCATGGCCGTCTTCACCAC
CTTTGCGGCCCTTACGTGGATCAAACGCATACCCTTCTCGGCCTTGATGCTCAAGACGTCTGTCGACGTTGCCCG
CAAATACGGCCACGTCTATCTCGTCAGCCTGCTCGGCGGCATCCTGGGCGTCATCCTGGCTGCGTGGTACGGCGT
CACGGTGACGGCCATCTACGTCCGCTTCCGACCCGATGACAACTGCAGCAGCGCCCAGGGCAAGAACTGCAGCAG
CGGCACCGTCATCGGCCTCATTGTCTATGCCACCTTTGCCATGTACTGGACGTCCGAGTGGCTGAAGAACACGGT
TCACACGACCGTGTCTGGCGTCTACGGCTCGTGGTACTTTTGCCCTCACAACTTTCCCAAGGCCGCCACCCGCGG
CGCCATGAAGCGCGCCCTCACCTACAGCTTTGGCTCCATCAGTCTTGGGAGCTTGCTGGTGGCCATTGTCAACAT
GTTGCGCCAGATCTGTTCCATCGCCGGTCAACAGGCTGCTAACGACGGCGGGGTTATGGATGTCGTCTTCTATGT
CATCTCCTTGATCGTCGGCTGCCTTCTCTCGCTTCTCCAGTGTAGGTTCCAGCCAGAGTTGATGAGGACGAGACT
GACTCACCTCTGCAGGGGCCATCGAGTTTGTCAACCGCTACGCCTTCTCGTACATTGCGCTGTATGGCAAGGCCT
ATTTCCCGGCGGCCAAGGACACGTGGACCATGATCCGGGATCGCGGCATCGACGCCCTGGTCAACGTGAGTCCTG
ACCCTTTCTTTCCCCTCCAACGCTGCCTGCTAAGACGCTCCTCCAGGAATGCCTCATCGGGCCCGTGCTCTCGTT
CGGGGCCATATTCATAGGCGCCGTCTGCACCCTGCTCGCCTTTCTCTTTGTCCGAATCAGCCACTCGCAGCTGCA
GTCCAACAACGGCTACTTGGCGGCCGTCATGGCCTTTGCCTTTCTCGTCGGCTTCCAGATCGCCAACATCTTTAC
GACGCCGATTTCGAGCGGCATCGACACCATCTTTGTCGCCTCGGGTTGGGATCCTCAGGTCATGTACAGCGAGCA
CCCGGAGCTGTATCAGGACATGGTGCGCGTGTATCCGCAGGTGCAGCAGGCCATCATTGCCCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail