Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4819
Gene name
LocationContig_453:8945..10462
Strand-
Gene length (bp)1517
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 21 38 17
2 100 122 22
3 135 157 22
4 167 189 22
5 201 223 22
6 261 283 22
7 342 364 22
8 384 403 19
9 408 430 22
10 445 467 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4819
MERQTRAGRRVLRLVWARDTYSSALIINLVAFFLPALYNSLSKLWMAKIDPSMVVTIDVYIYISTLAEILNEGLP
RASWSIIGNTSKRSSTERLAITKTLLLTQALLGLVVSLTLLIGAPSFARFFVPSEVRSRSIIFVQISSFSALGSA
VEAAVAAGTRALDQPDVPLILSCVRFVVNIVLDLLFLSSWRVSRWEPTINMHAGIQLACNLTSALAGITYFLLRN
RGNGGRSGARPSWSALRLLMRPGIFTLVESAVRNALYLWIVSNIVSLGVTYATAWGVFNSIRWGLLMVPVSALEA
TTLTFVGHEWGRWRHEMASMGRPYASYTALLRISRPARVSTVLALVFEVPVSIFMSMAGIRYFARHLSGSDAVAK
VAERMWRTIDWCYIMYAVSTQLVAILLATRPKWYLWQSLTSNLLYVLPWAIFCQVKRLNEDDAWTYHALIFGGSL
VFSFVCTPIVLAIWVWVLRTGRAHLEAHP*
Coding >Ophun1|4819
ATGGAGAGGCAGACGCGCGCGGGCCGGCGCGTGCTGAGGCTCGTCTGGGCTCGGGACACGTATTCCAGCGCCCTC
ATCATCAACCTGGTTGCCTTCTTTCTACCAGCTTTGTATAACAGCCTGTCAAAGCTATGGATGGCCAAGATAGAC
CCTTCCATGGTCGTCACCATCGACGTCTACATTTACATCTCAACCCTGGCCGAGATCCTCAACGAAGGCCTCCCC
CGCGCCTCATGGTCCATCATCGGAAATACGAGCAAGCGGAGTTCAACTGAGCGCCTGGCCATCACCAAGACGCTT
CTCCTGACGCAGGCCCTCCTCGGGCTCGTCGTGTCGCTGACGCTGCTGATCGGAGCCCCCTCCTTCGCCCGCTTC
TTCGTCCCCAGCGAGGTTCGCAGTCGGAGCATCATCTTTGTCCAGATCAGCAGCTTCTCCGCGCTCGGGAGTGCC
GTTGAGGCGGCTGTAGCGGCTGGAACCCGTGCGCTGGACCAGCCCGATGTGCCCTTGATCCTCAGCTGCGTCCGG
TTCGTGGTGAATATCGTGTTGGATTTACTGTTTCTTTCCAGTTGGAGGGTTTCCAGATGGGAGCCCACGATCAAT
ATGCATGCTGGGATACAGCTGGCTTGCAACCTCACCTCGGCTCTGGCCGGTATCACCTACTTCCTGCTCCGGAAC
CGGGGGAACGGAGGCCGATCCGGAGCCCGGCCGAGCTGGTCGGCCCTCCGGCTGTTGATGCGTCCTGGCATCTTT
ACGCTGGTTGAATCTGCTGTTCGCAACGCGCTCTATCTCTGGATCGTCAGCAACATCGTCTCCCTGGGCGTCACG
TACGCGACTGCCTGGGGCGTTTTCAACTCGATCCGCTGGGGCCTTCTGATGGTGCCCGTTTCAGCTCTCGAAGCC
ACGACACTGACGTTTGTCGGGCATGAATGGGGACGGTGGCGGCATGAGATGGCCAGTATGGGACGTCCATACGCA
AGCTATACTGCTCTGCTGCGTATATCCCGCCCAGCTCGTGTCTCGACGGTTCTGGCACTCGTCTTTGAAGTGCCC
GTCTCCATCTTCATGTCCATGGCTGGCATCCGCTACTTTGCTCGTCATCTCAGCGGCAGTGACGCCGTCGCCAAG
GTGGCTGAGAGGATGTGGAGGACCATAGACTGGTGCTACATCATGTACGCCGTCTCGACGCAGCTGGTTGCTATC
CTGCTGGCCACGAGGCCCAAGTGGTATCTGTGGCAGAGTCTGACCAGCAACCTCCTCTACGTCCTGCCTTGGGCC
ATCTTTTGCCAGGTGAAGCGCCTCAACGAGGACGATGCCTGGACTTATCATGCCCTCATCTTCGGAGGCAGCCTG
GTGTTCAGCTTTGTTTGCACCCCTATTGTCCTGGCTATCTGGGTCTGGGTTCTGAGAACGGGCAGGGCGCACTTG
GAAGCTCACCCTTGA
Transcript >Ophun1|4819
ATGGAGAGGCAGACGCGCGCGGGCCGGCGCGTGCTGAGGCTCGTCTGGGCTCGGGACACGTATTCCAGCGCCCTC
ATCATCAACCTGGTTGCCTTCTTTCTACCAGCTTTGTATAACAGCCTGTCAAAGCTATGGATGGCCAAGATAGAC
CCTTCCATGGTCGTCACCATCGACGTCTACATTTACATCTCAACCCTGGCCGAGATCCTCAACGAAGGCCTCCCC
CGCGCCTCATGGTCCATCATCGGAAATACGAGCAAGCGGAGTTCAACTGAGCGCCTGGCCATCACCAAGACGCTT
CTCCTGACGCAGGCCCTCCTCGGGCTCGTCGTGTCGCTGACGCTGCTGATCGGAGCCCCCTCCTTCGCCCGCTTC
TTCGTCCCCAGCGAGGTTCGCAGTCGGAGCATCATCTTTGTCCAGATCAGCAGCTTCTCCGCGCTCGGGAGTGCC
GTTGAGGCGGCTGTAGCGGCTGGAACCCGTGCGCTGGACCAGCCCGATGTGCCCTTGATCCTCAGCTGCGTCCGG
TTCGTGGTGAATATCGTGTTGGATTTACTGTTTCTTTCCAGTTGGAGGGTTTCCAGATGGGAGCCCACGATCAAT
ATGCATGCTGGGATACAGCTGGCTTGCAACCTCACCTCGGCTCTGGCCGGTATCACCTACTTCCTGCTCCGGAAC
CGGGGGAACGGAGGCCGATCCGGAGCCCGGCCGAGCTGGTCGGCCCTCCGGCTGTTGATGCGTCCTGGCATCTTT
ACGCTGGTTGAATCTGCTGTTCGCAACGCGCTCTATCTCTGGATCGTCAGCAACATCGTCTCCCTGGGCGTCACG
TACGCGACTGCCTGGGGCGTTTTCAACTCGATCCGCTGGGGCCTTCTGATGGTGCCCGTTTCAGCTCTCGAAGCC
ACGACACTGACGTTTGTCGGGCATGAATGGGGACGGTGGCGGCATGAGATGGCCAGTATGGGACGTCCATACGCA
AGCTATACTGCTCTGCTGCGTATATCCCGCCCAGCTCGTGTCTCGACGGTTCTGGCACTCGTCTTTGAAGTGCCC
GTCTCCATCTTCATGTCCATGGCTGGCATCCGCTACTTTGCTCGTCATCTCAGCGGCAGTGACGCCGTCGCCAAG
GTGGCTGAGAGGATGTGGAGGACCATAGACTGGTGCTACATCATGTACGCCGTCTCGACGCAGCTGGTTGCTATC
CTGCTGGCCACGAGGCCCAAGTGGTATCTGTGGCAGAGTCTGACCAGCAACCTCCTCTACGTCCTGCCTTGGGCC
ATCTTTTGCCAGGTGAAGCGCCTCAACGAGGACGATGCCTGGACTTATCATGCCCTCATCTTCGGAGGCAGCCTG
GTGTTCAGCTTTGTTTGCACCCCTATTGTCCTGGCTATCTGGGTCTGGGTTCTGAGAACGGGCAGGGCGCACTTG
GAAGCTCACCCTTGA
Gene >Ophun1|4819
ATGGAGAGGCAGACGCGCGCGGGCCGGCGCGTGCTGAGGCTCGTCTGGGCTCGGGACACGTATTCCAGCGCCCTC
ATCATCAACCTGGTTGCCTTCTTTCTACCAGCTTTGTATAACAGCCTGTCAAAGCTATGGATGGCCAAGATAGAC
CCTTCCATGGTCGTCACCATCGAGTCAGTACCTTCAAGTTGCCTCCCCCAAGAGGCCACATCCCAGCAACATACC
TGATACTGACATAGCCTTCCCTCAGCGTCTACATTTACATCTCAACCCTGGCCGAGATCCTCAACGAAGGCCTCC
CCCGCGCCTCATGGTCCATCATCGGAAATACGAGCAAGCGGAGTTCAACTGAGCGCCTGGCCATCACCAAGACGC
TTCTCCTGACGCAGGCCCTCCTCGGGCTCGTCGTGTCGCTGACGCTGCTGATCGGAGCCCCCTCCTTCGCCCGCT
TCTTCGTCCCCAGCGAGGTTCGCAGTCGGAGCATCATCTTTGTCCAGATCAGCAGCTTCTCCGCGCTCGGGAGTG
CCGTTGAGGCGGCTGTAGCGGCTGGAACCCGTGCGCTGGACCAGCCCGATGTGCCCTTGATCCTCAGCTGCGTCC
GGTTCGTGGTGAATATCGTGTTGGATTTACTGTTTCTTTCCAGTTGGAGGGTTTCCAGATGGGAGCCCACGATCA
ATATGCATGCTGGGATACAGCTGGCTTGCAACCTCACCTCGGCTCTGGCCGGTATCACCTACTTCCTGCTCCGGA
ACCGGGGGAACGGAGGCCGATCCGGAGCCCGGCCGAGCTGGTCGGCCCTCCGGCTGTTGATGCGTCCTGGCATCT
TTACGCTGGTTGAATCTGCTGTTCGCAACGCGCTCTATCTCTGGATCGTCAGCAACATCGTCTCCCTGGGCGTCA
CGTACGCGACTGCCTGGGGCGTTTTCAACTCGATCCGCTGGGGCCTTCTGATGGTGCCCGTTTCAGCTCTCGAAG
CCACGACACTGACGTTTGTCGGGCATGAATGGGGACGGTGGCGGCATGAGATGGCCAGTATGGGACGTCCATACG
CAAGCTATACTGCTCTGCTGCGTATATCCCGCCCAGCTCGTGTCTCGACGGTTCTGGCACTCGTCTTTGAAGTGC
CCGTCTCCATCTTCATGTCCATGGCTGGCATCCGCTACTTTGCTCGTCATCTCAGCGGCAGTGACGCCGTCGCCA
AGGTGGCTGAGAGGATGTGGAGGACCATAGACTGGTGCTACATCATGTACGCCGTCTCGACGCAGCTGGTTGCTA
TCCTGCTGGCCACGAGGCCCAAGTGGTATCTGTGGCAGAGTCTGACCAGCAACCTCCTCTACGTCCTGCCTTGGG
CCATCTTTTGCCAGGTGAAGCGCCTCAACGAGGACGATGCCTGGACTTATCATGCCCTCATCTTCGGAGGCAGCC
TGGTGTTCAGCTTTGTTTGCACCCCTATTGTCCTGGCTATCTGGGTCTGGGTTCTGAGAACGGGCAGGGCGCACT
TGGAAGCTCACCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail