Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4817
Gene name
LocationContig_453:5455..6574
Strand-
Gene length (bp)1119
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20246 DUF6601 Family of unknown function (DUF6601) 5.7E-74 92 329

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 282 304 22
2 324 346 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup798
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|876
Ophiocordyceps australis map64 (Brazil) OphauB2|1463
Ophiocordyceps camponoti-floridani Ophcf2|02782
Ophiocordyceps camponoti-rufipedis Ophun1|4817 (this protein)
Ophiocordyceps kimflemingae Ophio5|8329
Ophiocordyceps subramaniannii Hirsu2|3480
Ophiocordyceps subramaniannii Hirsu2|8260

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4817
MSSRSPVVMRAVDPSAVDAEPPFKRELAPVVNGRFRDDSSNSGESSMTSAASQLCSTSSDALHVPSYHDITPTLY
LPGGKKRAKVVPITTTEQYLQASFDLERLHHVQKRLWLAGLPFPARSLHRQKILGREIVITDQSDLHLTWRESTL
FLKPLWEPLLDYDFWQDELCGKDLKTYLSATGLLMSYIWLICSEPDLLIAKQHNLVPKKLSWAAWAVFSRDFLTK
HSIEGHNPHIAKRYDYGELRVQRLNLIYRFAPETFPRYLIRGYLYGYNRFSQFFGRNFAWAAVAVLYASVVLAAM
QVALAVPPIKDDVSFQRAAYGFTVFILVAMVFLSTVALVYLVIMVIKNLIFTRKRVRQHERRAVKKGGAVEP*
Coding >Ophun1|4817
ATGTCATCGAGATCGCCGGTCGTAATGAGAGCCGTCGATCCGAGCGCAGTGGACGCCGAGCCTCCCTTCAAGAGA
GAGTTGGCGCCCGTCGTCAACGGAAGATTTCGAGATGATTCGAGCAATTCCGGTGAAAGCTCGATGACCTCTGCT
GCGAGCCAACTCTGCTCGACGTCTTCAGATGCCCTTCATGTCCCGTCTTACCATGACATCACGCCGACTCTCTAC
CTCCCAGGCGGTAAAAAGAGAGCAAAAGTCGTTCCCATCACCACCACCGAGCAATATCTCCAAGCGTCATTCGAT
CTAGAACGTCTCCATCATGTTCAGAAGCGGCTATGGCTGGCCGGCCTCCCTTTTCCCGCCCGCTCGTTGCATCGA
CAAAAGATACTCGGCCGCGAGATTGTCATCACGGACCAGTCAGATCTGCACCTCACTTGGAGGGAGTCGACTCTC
TTCCTCAAGCCCTTATGGGAACCCCTTCTCGATTATGACTTCTGGCAAGATGAGCTCTGCGGGAAAGACCTCAAG
ACCTATCTCAGCGCCACCGGGCTTCTCATGTCTTACATCTGGCTCATCTGCTCCGAACCTGACCTGCTGATCGCA
AAGCAGCACAACTTGGTGCCCAAGAAGCTCAGCTGGGCCGCATGGGCCGTCTTCTCCCGAGATTTCCTCACAAAG
CATTCTATAGAGGGCCATAACCCACACATCGCCAAGCGATATGACTATGGCGAGTTGCGAGTCCAGCGCCTCAAC
TTGATCTATCGGTTCGCGCCCGAGACGTTTCCAAGGTACCTCATTCGCGGCTATCTCTACGGCTACAACCGCTTC
AGCCAGTTCTTTGGCCGTAACTTTGCCTGGGCGGCCGTGGCGGTGCTGTATGCCAGTGTCGTGCTGGCGGCTATG
CAGGTGGCGCTCGCCGTGCCCCCTATCAAGGACGACGTGAGTTTCCAGAGGGCGGCTTATGGATTCACCGTCTTC
ATCCTGGTTGCCATGGTCTTCCTCTCTACTGTCGCGCTGGTGTATCTTGTCATCATGGTTATCAAGAACCTCATC
TTTACCAGGAAAAGGGTCAGGCAACATGAACGACGTGCAGTCAAGAAGGGCGGAGCCGTCGAACCATAG
Transcript >Ophun1|4817
ATGTCATCGAGATCGCCGGTCGTAATGAGAGCCGTCGATCCGAGCGCAGTGGACGCCGAGCCTCCCTTCAAGAGA
GAGTTGGCGCCCGTCGTCAACGGAAGATTTCGAGATGATTCGAGCAATTCCGGTGAAAGCTCGATGACCTCTGCT
GCGAGCCAACTCTGCTCGACGTCTTCAGATGCCCTTCATGTCCCGTCTTACCATGACATCACGCCGACTCTCTAC
CTCCCAGGCGGTAAAAAGAGAGCAAAAGTCGTTCCCATCACCACCACCGAGCAATATCTCCAAGCGTCATTCGAT
CTAGAACGTCTCCATCATGTTCAGAAGCGGCTATGGCTGGCCGGCCTCCCTTTTCCCGCCCGCTCGTTGCATCGA
CAAAAGATACTCGGCCGCGAGATTGTCATCACGGACCAGTCAGATCTGCACCTCACTTGGAGGGAGTCGACTCTC
TTCCTCAAGCCCTTATGGGAACCCCTTCTCGATTATGACTTCTGGCAAGATGAGCTCTGCGGGAAAGACCTCAAG
ACCTATCTCAGCGCCACCGGGCTTCTCATGTCTTACATCTGGCTCATCTGCTCCGAACCTGACCTGCTGATCGCA
AAGCAGCACAACTTGGTGCCCAAGAAGCTCAGCTGGGCCGCATGGGCCGTCTTCTCCCGAGATTTCCTCACAAAG
CATTCTATAGAGGGCCATAACCCACACATCGCCAAGCGATATGACTATGGCGAGTTGCGAGTCCAGCGCCTCAAC
TTGATCTATCGGTTCGCGCCCGAGACGTTTCCAAGGTACCTCATTCGCGGCTATCTCTACGGCTACAACCGCTTC
AGCCAGTTCTTTGGCCGTAACTTTGCCTGGGCGGCCGTGGCGGTGCTGTATGCCAGTGTCGTGCTGGCGGCTATG
CAGGTGGCGCTCGCCGTGCCCCCTATCAAGGACGACGTGAGTTTCCAGAGGGCGGCTTATGGATTCACCGTCTTC
ATCCTGGTTGCCATGGTCTTCCTCTCTACTGTCGCGCTGGTGTATCTTGTCATCATGGTTATCAAGAACCTCATC
TTTACCAGGAAAAGGGTCAGGCAACATGAACGACGTGCAGTCAAGAAGGGCGGAGCCGTCGAACCATAG
Gene >Ophun1|4817
ATGTCATCGAGATCGCCGGTCGTAATGAGAGCCGTCGATCCGAGCGCAGTGGACGCCGAGCCTCCCTTCAAGAGA
GAGTTGGCGCCCGTCGTCAACGGAAGATTTCGAGATGATTCGAGCAATTCCGGTGAAAGCTCGATGACCTCTGCT
GCGAGCCAACTCTGCTCGACGTCTTCAGATGCCCTTCATGTCCCGTCTTACCATGACATCACGCCGACTCTCTAC
CTCCCAGGCGGTAAAAAGAGAGCAAAAGTCGTTCCCATCACCACCACCGAGCAATATCTCCAAGCGTCATTCGAT
CTAGAACGTCTCCATCATGTTCAGAAGCGGCTATGGCTGGCCGGCCTCCCTTTTCCCGCCCGCTCGTTGCATCGA
CAAAAGATACTCGGCCGCGAGATTGTCATCACGGACCAGTCAGATCTGCACCTCACTTGGAGGGAGTCGACTCTC
TTCCTCAAGCCCTTATGGGAACCCCTTCTCGATTATGACTTCTGGCAAGATGAGCTCTGCGGGAAAGACCTCAAG
ACCTATCTCAGCGCCACCGGGCTTCTCATGTCTTACATCTGGCTCATCTGCTCCGAACCTGACCTGCTGATCGCA
AAGCAGCACAACTTGGTGCCCAAGAAGCTCAGCTGGGCCGCATGGGCCGTCTTCTCCCGAGATTTCCTCACAAAG
CATTCTATAGAGGGCCATAACCCACACATCGCCAAGCGATATGACTATGGCGAGTTGCGAGTCCAGCGCCTCAAC
TTGATCTATCGGTTCGCGCCCGAGACGTTTCCAAGGTACCTCATTCGCGGCTATCTCTACGGCTACAACCGCTTC
AGCCAGTTCTTTGGCCGTAACTTTGCCTGGGCGGCCGTGGCGGTGCTGTATGCCAGTGTCGTGCTGGCGGCTATG
CAGGTGGCGCTCGCCGTGCCCCCTATCAAGGACGACGTGAGTTTCCAGAGGGCGGCTTATGGATTCACCGTCTTC
ATCCTGGTTGCCATGGTCTTCCTCTCTACTGTCGCGCTGGTGTATCTTGTCATCATGGTTATCAAGAACCTCATC
TTTACCAGGAAAAGGGTCAGGCAACATGAACGACGTGCAGTCAAGAAGGGCGGAGCCGTCGAACCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail