Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4815
Gene name
LocationContig_453:654..4133
Strand-
Gene length (bp)3479
Transcript length (bp)3426
Coding sequence length (bp)3426
Protein length (aa) 1142

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05362 Lon_C Lon protease (S16) C-terminal proteolytic domain 2.4E-64 899 1104
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 2.5E-30 175 472
PF00004 AAA ATPase family associated with various cellular activities (AAA) 5.9E-21 624 761
PF13541 ChlI Subunit ChlI of Mg-chelatase 2.8E-07 955 1074
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.4E-06 624 757

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8C4|LONM_NEUCR Lon protease homolog, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pim1 PE=3 SV=1 157 1119 0.0E+00
sp|A2QCJ2|LONM_ASPNC Lon protease homolog, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pim1 PE=3 SV=1 31 1135 0.0E+00
sp|Q4X0Z7|LONM_ASPFU Lon protease homolog, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pim1 PE=3 SV=1 76 1129 0.0E+00
sp|Q5AZT7|LONM_EMENI Lon protease homolog, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pim1 PE=3 SV=1 162 1124 0.0E+00
sp|P36775|LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIM1 PE=1 SV=2 164 1124 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8C4|LONM_NEUCR Lon protease homolog, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pim1 PE=3 SV=1 157 1119 0.0E+00
sp|A2QCJ2|LONM_ASPNC Lon protease homolog, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pim1 PE=3 SV=1 31 1135 0.0E+00
sp|Q4X0Z7|LONM_ASPFU Lon protease homolog, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pim1 PE=3 SV=1 76 1129 0.0E+00
sp|Q5AZT7|LONM_EMENI Lon protease homolog, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pim1 PE=3 SV=1 162 1124 0.0E+00
sp|P36775|LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIM1 PE=1 SV=2 164 1124 0.0E+00
sp|Q6CNR9|LONM_KLULA Lon protease homolog, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PIM1 PE=3 SV=1 86 1114 0.0E+00
sp|Q6FPE6|LONM_CANGA Lon protease homolog, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PIM1 PE=3 SV=1 145 1124 0.0E+00
sp|Q09769|LONM_SCHPO Lon protease homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=3 SV=1 165 1140 0.0E+00
sp|Q754Q9|LONM_ASHGO Lon protease homolog, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PIM1 PE=3 SV=2 168 1124 0.0E+00
sp|P0CQ17|LONM_CRYNB Lon protease homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PIM1 PE=3 SV=1 87 1090 0.0E+00
sp|P0CQ16|LONM_CRYNJ Lon protease homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PIM1 PE=3 SV=1 87 1090 0.0E+00
sp|Q6C0B5|LONM_YARLI Lon protease homolog, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PIM1 PE=3 SV=1 164 1124 0.0E+00
sp|Q924S5|LONM_RAT Lon protease homolog, mitochondrial OS=Rattus norvegicus GN=Lonp1 PE=2 SV=1 111 1113 0.0E+00
sp|Q8CGK3|LONM_MOUSE Lon protease homolog, mitochondrial OS=Mus musculus GN=Lonp1 PE=1 SV=2 128 1113 0.0E+00
sp|P36776|LONM_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens GN=LONP1 PE=1 SV=2 371 1106 0.0E+00
sp|P93655|LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana GN=LON1 PE=1 SV=2 375 1105 0.0E+00
sp|P93648|LONM_MAIZE Lon protease homolog, mitochondrial OS=Zea mays GN=LON2 PE=1 SV=1 375 1107 0.0E+00
sp|O44952|LONM_CAEEL Lon protease homolog, mitochondrial OS=Caenorhabditis elegans GN=C34B2.6 PE=3 SV=1 168 1105 0.0E+00
sp|Q59HJ6|LONM_BOVIN Lon protease homolog, mitochondrial OS=Bos taurus GN=LONP1 PE=1 SV=1 371 1106 0.0E+00
sp|A2YQ56|LONM_ORYSI Lon protease homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_27415 PE=2 SV=1 375 1107 0.0E+00
sp|Q69UZ3|LONM_ORYSJ Lon protease homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0689300 PE=2 SV=1 375 1107 0.0E+00
sp|Q00WL5|LONM_OSTTA Lon protease homolog, mitochondrial OS=Ostreococcus tauri GN=Ot13g03040 PE=3 SV=2 374 1101 0.0E+00
sp|A8XFM8|LONM_CAEBR Lon protease homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG12802 PE=3 SV=3 372 1105 0.0E+00
sp|Q6ME13|LON_PARUW Lon protease OS=Protochlamydia amoebophila (strain UWE25) GN=lon PE=3 SV=1 363 1116 0.0E+00
sp|Q7KUT2|LONM_DROME Lon protease homolog, mitochondrial OS=Drosophila melanogaster GN=Lon PE=1 SV=1 168 1137 0.0E+00
sp|Q9M9L7|LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=LON4 PE=3 SV=1 352 1105 0.0E+00
sp|B7FSL4|LONM_PHATC Lon protease homolog, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_18202 PE=3 SV=1 391 1109 0.0E+00
sp|O84348|LON_CHLTR Lon protease OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lon PE=3 SV=1 392 1108 0.0E+00
sp|Q9PK50|LON_CHLMU Lon protease OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lon PE=3 SV=1 392 1108 0.0E+00
sp|Q3A701|LON1_PELCD Lon protease 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lon1 PE=3 SV=1 389 1105 0.0E+00
sp|Q6BKJ4|LONM_DEBHA Lon protease homolog, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PIM1 PE=3 SV=2 363 1124 0.0E+00
sp|Q9Z9F4|LON_CHLPN Lon protease OS=Chlamydia pneumoniae GN=lon PE=3 SV=1 392 1108 0.0E+00
sp|A3M072|LONM_PICST Lon protease homolog, mitochondrial (Fragment) OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PIM1 PE=3 SV=3 351 1124 0.0E+00
sp|Q9M9L8|LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana GN=LON3 PE=3 SV=1 375 1105 0.0E+00
sp|A0L516|LON_MAGMM Lon protease OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lon PE=3 SV=1 372 1105 0.0E+00
sp|Q5A6N1|LONM_CANAL Lon protease homolog, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIM1 PE=3 SV=1 353 1124 0.0E+00
sp|Q31FD3|LON2_THICR Lon protease 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=lon2 PE=3 SV=2 379 1105 0.0E+00
sp|B9WLN5|LONM_CANDC Lon protease homolog, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PIM1 PE=3 SV=1 364 1124 0.0E+00
sp|Q550C8|LONM2_DICDI Lon protease homolog, mitochondrial 2 OS=Dictyostelium discoideum GN=DDB_0217928 PE=3 SV=1 436 1105 0.0E+00
sp|Q1IPZ8|LON_KORVE Lon protease OS=Koribacter versatilis (strain Ellin345) GN=lon PE=3 SV=1 376 1107 0.0E+00
sp|Q54YV4|LONM1_DICDI Lon protease homolog, mitochondrial 1 OS=Dictyostelium discoideum GN=DDB_G0278063 PE=3 SV=3 374 1107 0.0E+00
sp|B5RL78|LON_BORDL Lon protease OS=Borrelia duttonii (strain Ly) GN=lon PE=3 SV=1 374 1105 8.0E-174
sp|A4S6Y4|LONM_OSTLU Lon protease homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_41620 PE=3 SV=1 374 834 2.0E-172
sp|A8ZX50|LON_DESOH Lon protease OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lon PE=3 SV=1 394 1105 2.0E-170
sp|Q59185|LON1_BORBU Lon protease 1 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lon1 PE=3 SV=1 424 1105 9.0E-170
sp|A4XJL4|LON_CALS8 Lon protease OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lon PE=3 SV=1 374 1103 2.0E-169
sp|B5EDX8|LON_GEOBB Lon protease OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lon PE=3 SV=1 428 1101 4.0E-167
sp|Q2LVS9|LON_SYNAS Lon protease OS=Syntrophus aciditrophicus (strain SB) GN=lon PE=3 SV=1 388 1105 1.0E-166
sp|A0RJ87|LON_BACAH Lon protease OS=Bacillus thuringiensis (strain Al Hakam) GN=lon PE=3 SV=1 377 1102 6.0E-166
sp|O69177|LON_RHIME Lon protease OS=Rhizobium meliloti (strain 1021) GN=lon PE=3 SV=2 350 1101 9.0E-165
sp|B8G736|LON_CHLAD Lon protease OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=lon PE=3 SV=1 430 1105 3.0E-164
sp|O66605|LON_AQUAE Lon protease OS=Aquifex aeolicus (strain VF5) GN=lon PE=1 SV=1 430 1105 3.0E-164
sp|A4J7L6|LON_DESRM Lon protease OS=Desulfotomaculum reducens (strain MI-1) GN=lon PE=3 SV=1 430 1120 6.0E-164
sp|P36772|LON_BRECH Lon protease OS=Brevibacillus choshinensis GN=lon PE=3 SV=1 430 1101 1.0E-162
sp|A7NM80|LON_ROSCS Lon protease OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=lon PE=3 SV=1 389 1105 1.0E-161
sp|P0C113|LON_BRUAB Lon protease OS=Brucella abortus biovar 1 (strain 9-941) GN=lon PE=3 SV=1 392 1101 1.0E-161
sp|Q2YPX3|LON_BRUA2 Lon protease OS=Brucella abortus (strain 2308) GN=lon PE=2 SV=1 392 1101 1.0E-161
sp|Q8G0I7|LON_BRUSU Lon protease OS=Brucella suis biovar 1 (strain 1330) GN=lon PE=3 SV=1 392 1101 2.0E-161
sp|Q8YHC6|LON_BRUME Lon protease OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lon PE=3 SV=2 392 1101 2.0E-161
sp|Q5H432|LON_XANOR Lon protease OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lon PE=3 SV=1 383 1105 8.0E-161
sp|Q1MS21|LON_LAWIP Lon protease OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lon PE=3 SV=1 430 1105 9.0E-161
sp|P37945|LON1_BACSU Lon protease 1 OS=Bacillus subtilis (strain 168) GN=lon1 PE=1 SV=1 430 1102 1.0E-160
sp|B5YFG2|LON_DICT6 Lon protease OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=lon PE=3 SV=1 380 1105 1.0E-160
sp|A9B3R2|LON2_HERA2 Lon protease 2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=lon2 PE=3 SV=1 436 1107 3.0E-160
sp|Q72KS4|LON1_THET2 Lon protease 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lon1 PE=3 SV=1 378 1101 1.0E-158
sp|P57549|LON_BUCAI Lon protease OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lon PE=3 SV=1 428 1103 7.0E-158
sp|B8J198|LON_DESDA Lon protease OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=lon PE=3 SV=1 430 1105 2.0E-157
sp|Q72JM6|LON2_THET2 Lon protease 2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lon2 PE=3 SV=1 378 1105 6.0E-157
sp|Q39QP7|LON_GEOMG Lon protease OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lon PE=3 SV=1 430 1085 7.0E-157
sp|B8EMF2|LON_METSB Lon protease OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lon PE=3 SV=1 359 1102 8.0E-157
sp|A0LG61|LON2_SYNFM Lon protease 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lon2 PE=3 SV=1 377 1107 1.0E-156
sp|A9GBF1|LON2_SORC5 Lon protease 2 OS=Sorangium cellulosum (strain So ce56) GN=lon2 PE=3 SV=1 377 1124 1.0E-156
sp|B3E7K2|LON_GEOLS Lon protease OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=lon PE=3 SV=1 430 1105 1.0E-156
sp|Q2IIK1|LON_ANADE Lon protease OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lon PE=3 SV=1 391 1101 3.0E-156
sp|P0A9M0|LON_ECOLI Lon protease OS=Escherichia coli (strain K12) GN=lon PE=1 SV=1 421 1105 4.0E-156
sp|P0A9M1|LON_ECOL6 Lon protease OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lon PE=3 SV=1 421 1105 4.0E-156
sp|A6LD45|LON_PARD8 Lon protease OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lon PE=3 SV=1 414 1114 1.0E-155
sp|A9KH99|LON_CLOPH Lon protease OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lon PE=3 SV=1 450 1101 2.0E-155
sp|Q72CE6|LON_DESVH Lon protease OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lon PE=3 SV=1 452 1101 3.0E-155
sp|B2KCC0|LON_ELUMP Lon protease OS=Elusimicrobium minutum (strain Pei191) GN=lon PE=3 SV=1 384 1105 2.0E-154
sp|B3QSJ7|LON_CHLT3 Lon protease OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=lon PE=3 SV=1 436 1104 2.0E-154
sp|B1GZQ6|LON_UNCTG Lon protease OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=lon PE=3 SV=1 388 1108 4.0E-154
sp|Q0AWF3|LON_SYNWW Lon protease OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lon PE=3 SV=1 375 1109 5.0E-154
sp|P77810|LON_AZOBR Lon protease OS=Azospirillum brasilense GN=lon PE=2 SV=1 388 1132 9.0E-154
sp|P36774|LON2_MYXXA Lon protease 2 OS=Myxococcus xanthus GN=lon2 PE=1 SV=3 391 1101 1.0E-153
sp|Q32JJ5|LON_SHIDS Lon protease OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lon PE=3 SV=1 421 1094 2.0E-153
sp|A8HYF7|LON_AZOC5 Lon protease OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lon PE=3 SV=1 394 1101 2.0E-153
sp|A9WGB5|LON_CHLAA Lon protease OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=lon PE=3 SV=1 388 1082 1.0E-152
sp|Q89A99|LON_BUCBP Lon protease OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lon PE=3 SV=1 428 1103 2.0E-152
sp|B8CY71|LON_HALOH Lon protease OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=lon PE=3 SV=1 392 1105 3.0E-152
sp|Q3JBB6|LON_NITOC Lon protease OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lon PE=3 SV=1 464 1110 7.0E-152
sp|Q11QT1|LON_CYTH3 Lon protease OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lon PE=3 SV=1 423 1081 1.0E-151
sp|A8M1E8|LON_SALAI Lon protease OS=Salinispora arenicola (strain CNS-205) GN=lon PE=3 SV=1 435 1105 6.0E-151
sp|P43864|LON_HAEIN Lon protease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lon PE=3 SV=1 430 1101 7.0E-151
sp|P46067|LON_ERWAM Lon protease OS=Erwinia amylovora GN=lon PE=2 SV=1 428 1105 9.0E-151
sp|B5Y8Q8|LON_COPPD Lon protease OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=lon PE=3 SV=1 433 1105 2.0E-150
sp|Q026Q2|LON_SOLUE Lon protease OS=Solibacter usitatus (strain Ellin6076) GN=lon PE=3 SV=1 390 1111 2.0E-150
sp|Q8K988|LON_BUCAP Lon protease OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lon PE=3 SV=1 435 1105 9.0E-150
sp|B0TFI9|LON_HELMI Lon protease OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lon PE=3 SV=1 386 1089 1.0E-149
sp|A5EWF3|LON_DICNV Lon protease OS=Dichelobacter nodosus (strain VCS1703A) GN=lon PE=3 SV=1 430 1105 1.0E-149
sp|B3CLB3|LON_WOLPP Lon protease OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lon PE=3 SV=1 391 1090 2.0E-149
sp|Q9RXG4|LON_DEIRA Lon protease OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lon PE=3 SV=1 392 1105 2.0E-149
sp|Q31GE9|LON1_THICR Lon protease 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=lon1 PE=3 SV=1 430 1139 3.0E-149
sp|A5FG89|LON_FLAJ1 Lon protease OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lon PE=3 SV=1 376 1117 4.0E-149
sp|A9F8L0|LON4_SORC5 Lon protease 4 OS=Sorangium cellulosum (strain So ce56) GN=lon4 PE=3 SV=1 339 1086 8.0E-149
sp|A0LEE9|LON1_SYNFM Lon protease 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lon1 PE=3 SV=1 430 1111 1.0E-148
sp|B7GXS7|LON_ACIB3 Lon protease OS=Acinetobacter baumannii (strain AB307-0294) GN=lon PE=3 SV=1 452 1108 2.0E-147
sp|A7HK39|LON_FERNB Lon protease OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=lon PE=3 SV=1 430 1117 2.0E-147
sp|Q3A334|LON2_PELCD Lon protease 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lon2 PE=3 SV=1 430 1085 2.0E-146
sp|B2TFQ5|LON_BURPP Lon protease OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lon PE=3 SV=1 342 1082 3.0E-145
sp|P0CAW0|LON_CAUCR Lon protease OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lon PE=3 SV=1 430 1101 3.0E-144
sp|B8GX12|LON_CAUCN Lon protease OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lon PE=3 SV=1 430 1101 3.0E-144
sp|Q8RHK0|LON_FUSNN Lon protease OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lon PE=3 SV=1 412 1105 7.0E-144
sp|Q6MGP8|LON2_BDEBA Lon protease 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lon2 PE=3 SV=1 430 1105 2.0E-143
sp|A8F811|LON_PSELT Lon protease OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=lon PE=3 SV=1 430 1090 1.0E-142
sp|Q180E4|LON_PEPD6 Lon protease OS=Peptoclostridium difficile (strain 630) GN=lon PE=3 SV=2 430 1102 4.0E-142
sp|Q0J032|LONP2_ORYSJ Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. japonica GN=Os09g0533400 PE=2 SV=1 389 1105 1.0E-141
sp|B8BDV1|LONP2_ORYSI Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. indica GN=LON1 PE=2 SV=1 389 1105 3.0E-141
sp|P55995|LON_HELPY Lon protease OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lon PE=3 SV=1 381 1102 3.0E-141
sp|B0TZA7|LON_FRAP2 Lon protease OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=lon PE=3 SV=1 432 1105 3.0E-141
sp|Q5PQY6|LONP2_DANRE Lon protease homolog 2, peroxisomal OS=Danio rerio GN=lonp2 PE=2 SV=1 436 1107 9.0E-141
sp|B2RII6|LON_PORG3 Lon protease OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lon PE=3 SV=1 433 1101 2.0E-140
sp|Q9DBN5|LONP2_MOUSE Lon protease homolog 2, peroxisomal OS=Mus musculus GN=Lonp2 PE=1 SV=1 453 1105 4.0E-140
sp|A9B5N1|LON1_HERA2 Lon protease 1 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=lon1 PE=3 SV=1 398 1105 1.0E-139
sp|O04979|LONP2_SPIOL Lon protease homolog 2, peroxisomal OS=Spinacia oleracea PE=2 SV=2 435 1090 1.0E-139
sp|Q6AK61|LON2_DESPS Lon protease 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lon2 PE=3 SV=1 375 1102 1.0E-139
sp|Q3MIB4|LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus GN=Lonp2 PE=1 SV=2 453 1105 2.0E-139
sp|A9GIS9|LON3_SORC5 Lon protease 3 OS=Sorangium cellulosum (strain So ce56) GN=lon3 PE=3 SV=1 430 1085 3.0E-139
sp|O51558|LON2_BORBU Lon protease 2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lon2 PE=3 SV=2 428 1104 3.0E-139
sp|Q9ZJL3|LON_HELPJ Lon protease OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lon PE=3 SV=1 381 1102 4.0E-139
sp|A8Z5Z0|LON_SULMW Lon protease OS=Sulcia muelleri (strain GWSS) GN=lon PE=3 SV=1 399 1103 2.0E-138
sp|P93647|LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays GN=LON1 PE=2 SV=1 389 1105 4.0E-138
sp|Q86WA8|LONP2_HUMAN Lon protease homolog 2, peroxisomal OS=Homo sapiens GN=LONP2 PE=1 SV=1 453 1105 7.0E-138
sp|Q3SX23|LONP2_BOVIN Lon protease homolog 2, peroxisomal OS=Bos taurus GN=LONP2 PE=2 SV=1 534 1105 2.0E-137
sp|Q5R6M5|LONP2_PONAB Lon protease homolog 2, peroxisomal OS=Pongo abelii GN=LONP2 PE=2 SV=1 534 1105 7.0E-137
sp|B3ERM8|LON_AMOA5 Lon protease OS=Amoebophilus asiaticus (strain 5a2) GN=lon PE=3 SV=1 443 1133 1.0E-136
sp|Q6AS16|LON1_DESPS Lon protease 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lon1 PE=3 SV=1 357 828 2.0E-136
sp|Q2TAF8|LONP2_XENLA Lon protease homolog 2, peroxisomal OS=Xenopus laevis GN=lonp2 PE=2 SV=1 535 1105 3.0E-136
sp|Q2GE60|LON_NEOSM Lon protease OS=Neorickettsia sennetsu (strain Miyayama) GN=lon PE=3 SV=1 374 1089 4.0E-135
sp|O64948|LONP2_ARATH Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana GN=LON2 PE=2 SV=1 435 1085 6.0E-135
sp|A7ZEJ3|LON_CAMC1 Lon protease OS=Campylobacter concisus (strain 13826) GN=lon PE=3 SV=1 459 1101 9.0E-135
sp|O31147|LON_MYCSM Lon protease OS=Mycobacterium smegmatis GN=lon PE=1 SV=1 428 1090 2.0E-134
sp|Q1RID6|LON_RICBR Lon protease OS=Rickettsia bellii (strain RML369-C) GN=lon PE=3 SV=1 463 1102 3.0E-134
sp|A6LSV5|LON_CLOB8 Lon protease OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=lon PE=3 SV=1 434 1101 9.0E-134
sp|Q0RPW3|LON_FRAAA Lon protease OS=Frankia alni (strain ACN14a) GN=lon PE=3 SV=1 407 1116 3.0E-133
sp|Q2NEP8|LON_METST Lon protease OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=lon PE=3 SV=1 410 1101 5.0E-133
sp|Q92HZ1|LON_RICCN Lon protease OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lon PE=3 SV=2 378 1101 3.0E-132
sp|Q97FT9|LON_CLOAB Lon protease OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lon PE=3 SV=1 430 1086 2.0E-131
sp|B3CUN9|LON_ORITI Lon protease OS=Orientia tsutsugamushi (strain Ikeda) GN=lon PE=3 SV=1 449 1107 5.0E-130
sp|Q469F5|LON_METBF Lon protease OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lon PE=3 SV=1 449 1084 2.0E-129
sp|Q4ULN0|LON_RICFE Lon protease OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lon PE=3 SV=1 463 1101 2.0E-128
sp|Q8EV77|LON_MYCPE Lon protease OS=Mycoplasma penetrans (strain HF-2) GN=lon PE=3 SV=1 452 1105 9.0E-127
sp|Q6C0L7|LONP2_YARLI Lon protease homolog 2, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F23595g PE=3 SV=1 434 1105 1.0E-126
sp|O83536|LON_TREPA Lon protease OS=Treponema pallidum (strain Nichols) GN=lon PE=3 SV=1 392 833 5.0E-126
sp|Q600B5|LON_MYCH2 Lon protease OS=Mycoplasma hyopneumoniae (strain 232) GN=lon PE=3 SV=1 479 1105 2.0E-125
sp|Q2NJE3|LON_AYWBP Lon protease OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lon PE=3 SV=1 463 1105 4.0E-124
sp|P47481|LON_MYCGE Lon protease OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=lon PE=3 SV=1 479 1105 5.0E-124
sp|B1AIY7|LON_UREP2 Lon protease OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=lon PE=3 SV=1 392 1105 2.0E-123
sp|B2V6N0|LON_SULSY Lon protease OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=lon PE=3 SV=1 430 821 8.0E-122
sp|Q72UP9|LON_LEPIC Lon protease OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lon PE=3 SV=1 367 835 6.0E-121
sp|A5IYF2|LON_MYCAP Lon protease OS=Mycoplasma agalactiae (strain PG2) GN=lon PE=3 SV=1 476 1105 7.0E-120
sp|B3PN08|LON_MYCA5 Lon protease OS=Mycoplasma arthritidis (strain 158L3-1) GN=lon PE=3 SV=1 454 1105 1.0E-119
sp|B8F9K1|LON_DESAA Lon protease OS=Desulfatibacillum alkenivorans (strain AK-01) GN=lon PE=3 SV=1 430 834 6.0E-119
sp|A2RAF6|LONP2_ASPNC Lon protease homolog 2, peroxisomal OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g02980 PE=3 SV=1 430 1106 2.0E-118
sp|Q4WVD9|LONP2_ASPFU Lon protease homolog 2, peroxisomal OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_5G11750 PE=3 SV=1 523 1106 4.0E-114
sp|Q6ML73|LON1_BDEBA Lon protease 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lon1 PE=3 SV=1 436 847 3.0E-110
sp|B4RI01|LON_PHEZH Lon protease OS=Phenylobacterium zucineum (strain HLK1) GN=lon PE=3 SV=1 431 834 1.0E-107
sp|P74956|LON_VIBPA Lon protease OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lon PE=3 SV=2 422 833 4.0E-107
sp|P36773|LON1_MYXXA Lon protease 1 OS=Myxococcus xanthus GN=lon1 PE=2 SV=1 388 834 2.0E-104
sp|Q2V573|LONP2_PICAN Lon protease homolog 2, peroxisomal OS=Pichia angusta GN=PLN PE=3 SV=1 497 1080 4.0E-103
sp|Q7SA85|LONP2_NEUCR Lon protease homolog 2, peroxisomal OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08303 PE=3 SV=1 623 1106 1.0E-102
sp|A9ETZ9|LON1_SORC5 Lon protease 1 OS=Sorangium cellulosum (strain So ce56) GN=lon1 PE=3 SV=1 422 821 2.0E-98
sp|Q6MTF4|LON_MYCMS Lon protease OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lon PE=3 SV=1 478 904 6.0E-98
sp|B0S2N4|LON_FINM2 Lon protease OS=Finegoldia magna (strain ATCC 29328) GN=lon PE=3 SV=1 432 828 6.0E-98
sp|Q6CWS4|LONP2_KLULA Lon protease homolog 2, peroxisomal OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0B01892g PE=3 SV=1 541 1080 1.0E-95
sp|Q9ZD92|LON_RICPR Lon protease OS=Rickettsia prowazekii (strain Madrid E) GN=lon PE=3 SV=1 362 833 3.0E-94
sp|Q68WS8|LON_RICTY Lon protease OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lon PE=3 SV=1 378 833 7.0E-94
sp|Q755E4|LONP2_ASHGO Lon protease homolog 2, peroxisomal OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFL121W PE=3 SV=2 541 1087 2.0E-92
sp|Q6BJJ8|LONP2_DEBHA Lon protease homolog 2, peroxisomal OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G01892g PE=3 SV=2 623 1120 6.0E-90
sp|O69300|LON_CAMJE Lon protease OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lon PE=2 SV=2 459 904 7.0E-89
sp|A3LUF7|LONP2_PICST Lon protease homolog 2, peroxisomal OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_45980 PE=3 SV=2 623 1080 5.0E-87
sp|Q6KI22|LON_MYCMO Lon protease OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lon PE=3 SV=1 474 831 9.0E-87
sp|P78025|LON_MYCPN Lon protease OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lon PE=3 SV=1 479 838 1.0E-85
sp|Q9XW87|LONP2_CAEEL Lon protease homolog 2, peroxisomal OS=Caenorhabditis elegans GN=Y75B8A.4 PE=3 SV=1 523 845 4.0E-84
sp|A8Y3E2|LONP2_CAEBR Lon protease homolog 2, peroxisomal OS=Caenorhabditis briggsae GN=CBG23035 PE=3 SV=2 434 843 5.0E-83
sp|Q5BH58|LONP2_EMENI Lon protease homolog 2, peroxisomal OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0122 PE=3 SV=1 392 832 2.0E-81
sp|Q4A696|LON_MYCS5 Lon protease OS=Mycoplasma synoviae (strain 53) GN=lon PE=3 SV=1 479 835 2.0E-74
sp|B9WEC4|LONP2_CANDC Lon protease homolog 2, peroxisomal OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_85340 PE=3 SV=1 623 1094 1.0E-73
sp|A4S6Y4|LONM_OSTLU Lon protease homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_41620 PE=3 SV=1 909 1101 2.0E-57
sp|Q59YV0|LONP2_CANAL Lon protease homolog 2, peroxisomal OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.6973 PE=3 SV=1 623 840 3.0E-56
sp|Q5UPT0|LONH_MIMIV Lon protease homolog OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L251 PE=3 SV=1 527 1078 6.0E-54
sp|O83536|LON_TREPA Lon protease OS=Treponema pallidum (strain Nichols) GN=lon PE=3 SV=1 877 1113 9.0E-47
sp|Q72UP9|LON_LEPIC Lon protease OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lon PE=3 SV=1 899 1105 2.0E-45
sp|Q6AS16|LON1_DESPS Lon protease 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lon1 PE=3 SV=1 867 1105 1.0E-41
sp|Q6ML73|LON1_BDEBA Lon protease 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lon1 PE=3 SV=1 903 1105 3.0E-38
sp|Q6KI22|LON_MYCMO Lon protease OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lon PE=3 SV=1 906 1108 2.0E-37
sp|B8F9K1|LON_DESAA Lon protease OS=Desulfatibacillum alkenivorans (strain AK-01) GN=lon PE=3 SV=1 898 1102 1.0E-36
sp|Q6MTF4|LON_MYCMS Lon protease OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lon PE=3 SV=1 907 1105 1.0E-36
sp|P74956|LON_VIBPA Lon protease OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lon PE=3 SV=2 893 1105 7.0E-36
sp|Q9ZD92|LON_RICPR Lon protease OS=Rickettsia prowazekii (strain Madrid E) GN=lon PE=3 SV=1 896 1101 2.0E-35
sp|B2V6N0|LON_SULSY Lon protease OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=lon PE=3 SV=1 904 1115 4.0E-35
sp|Q68WS8|LON_RICTY Lon protease OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lon PE=3 SV=1 882 1101 6.0E-35
sp|B4RI01|LON_PHEZH Lon protease OS=Phenylobacterium zucineum (strain HLK1) GN=lon PE=3 SV=1 897 1109 1.0E-34
sp|Q4A696|LON_MYCS5 Lon protease OS=Mycoplasma synoviae (strain 53) GN=lon PE=3 SV=1 892 1105 1.0E-33
sp|O69300|LON_CAMJE Lon protease OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lon PE=2 SV=2 880 1102 1.0E-32
sp|A9ETZ9|LON1_SORC5 Lon protease 1 OS=Sorangium cellulosum (strain So ce56) GN=lon1 PE=3 SV=1 903 1094 3.0E-32
sp|P36773|LON1_MYXXA Lon protease 1 OS=Myxococcus xanthus GN=lon1 PE=2 SV=1 907 1101 1.0E-31
sp|B0S2N4|LON_FINM2 Lon protease OS=Finegoldia magna (strain ATCC 29328) GN=lon PE=3 SV=1 904 1105 2.0E-30
sp|P78025|LON_MYCPN Lon protease OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lon PE=3 SV=1 925 1105 1.0E-29
sp|A8Y3E2|LONP2_CAEBR Lon protease homolog 2, peroxisomal OS=Caenorhabditis briggsae GN=CBG23035 PE=3 SV=2 923 1111 4.0E-24
sp|Q9XW87|LONP2_CAEEL Lon protease homolog 2, peroxisomal OS=Caenorhabditis elegans GN=Y75B8A.4 PE=3 SV=1 923 1090 6.0E-24
sp|Q5BH58|LONP2_EMENI Lon protease homolog 2, peroxisomal OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0122 PE=3 SV=1 903 1106 8.0E-23
sp|Q59YV0|LONP2_CANAL Lon protease homolog 2, peroxisomal OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.6973 PE=3 SV=1 957 1128 1.0E-19
sp|Q7SA85|LONP2_NEUCR Lon protease homolog 2, peroxisomal OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08303 PE=3 SV=1 433 619 2.0E-15
sp|P42425|LON2_BACSU Lon protease 2 OS=Bacillus subtilis (strain 168) GN=lon2 PE=2 SV=2 998 1112 1.0E-13
sp|P93655|LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana GN=LON1 PE=1 SV=2 169 286 2.0E-13
sp|P36776|LONM_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens GN=LONP1 PE=1 SV=2 158 274 1.0E-12
sp|Q9M9L7|LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=LON4 PE=3 SV=1 175 286 2.0E-12
sp|Q58812|LONB_METJA Archaeal Lon protease OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1417 PE=1 SV=1 925 1105 2.0E-12
sp|A2YQ56|LONM_ORYSI Lon protease homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_27415 PE=2 SV=1 166 286 5.0E-12
sp|Q69UZ3|LONM_ORYSJ Lon protease homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0689300 PE=2 SV=1 166 286 5.0E-12
sp|P93648|LONM_MAIZE Lon protease homolog, mitochondrial OS=Zea mays GN=LON2 PE=1 SV=1 175 286 8.0E-12
sp|O29883|LONB_ARCFU Archaeal Lon protease OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0364 PE=1 SV=1 961 1079 2.0E-11
sp|Q59HJ6|LONM_BOVIN Lon protease homolog, mitochondrial OS=Bos taurus GN=LONP1 PE=1 SV=1 158 274 3.0E-11
sp|Q6BKJ4|LONM_DEBHA Lon protease homolog, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PIM1 PE=3 SV=2 89 293 3.0E-11
sp|Q9HSC3|LONB_HALSA Archaeal Lon protease OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_0303G PE=3 SV=1 961 1105 8.0E-10
sp|Q9M9L8|LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana GN=LON3 PE=3 SV=1 175 286 2.0E-09
sp|A3M072|LONM_PICST Lon protease homolog, mitochondrial (Fragment) OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PIM1 PE=3 SV=3 172 327 3.0E-09
sp|O26878|LONB_METTH Archaeal Lon protease OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_785 PE=3 SV=1 948 1079 3.0E-09
sp|O58221|LONB_PYRHO Archaeal Lon protease OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0452 PE=3 SV=2 934 1077 1.0E-08
sp|A4S6Y4|LONM_OSTLU Lon protease homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_41620 PE=3 SV=1 169 245 8.0E-08
sp|Q5A6N1|LONM_CANAL Lon protease homolog, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIM1 PE=3 SV=1 158 275 1.0E-07
sp|Q00WL5|LONM_OSTTA Lon protease homolog, mitochondrial OS=Ostreococcus tauri GN=Ot13g03040 PE=3 SV=2 169 221 2.0E-07
sp|B9WLN5|LONM_CANDC Lon protease homolog, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PIM1 PE=3 SV=1 158 275 2.0E-07
sp|Q9HJ89|LONB_THEAC Archaeal Lon protease OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1081 PE=1 SV=1 961 1079 2.0E-07
sp|Q8NKS6|LONB_THEKO Archaeal Lon protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=lon PE=1 SV=1 929 1105 2.0E-07
sp|Q9UYC6|LONB_PYRAB Archaeal Lon protease OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=lon PE=3 SV=1 929 1077 2.0E-07
sp|B7FSL4|LONM_PHATC Lon protease homolog, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_18202 PE=3 SV=1 172 291 3.0E-07
sp|P58274|LONB_THEVO Archaeal Lon protease OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV0493 PE=3 SV=1 961 1079 6.0E-07
sp|A3LUF7|LONP2_PICST Lon protease homolog 2, peroxisomal OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_45980 PE=3 SV=2 558 617 7.0E-07
sp|Q6BJJ8|LONP2_DEBHA Lon protease homolog 2, peroxisomal OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G01892g PE=3 SV=2 558 617 9.0E-07
sp|B9WEC4|LONP2_CANDC Lon protease homolog 2, peroxisomal OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_85340 PE=3 SV=1 558 617 2.0E-06
sp|Q59YV0|LONP2_CANAL Lon protease homolog 2, peroxisomal OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.6973 PE=3 SV=1 558 617 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004176 ATP-dependent peptidase activity Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0005524 ATP binding Yes
GO:0006508 proteolysis Yes
GO:0097159 organic cyclic compound binding No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0008236 serine-type peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0008152 metabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0005488 binding No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0016462 pyrophosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0140657 ATP-dependent activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1944
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5836
Ophiocordyceps australis map64 (Brazil) OphauB2|1184
Ophiocordyceps camponoti-floridani Ophcf2|02780
Ophiocordyceps camponoti-rufipedis Ophun1|4815 (this protein)
Ophiocordyceps kimflemingae Ophio5|7192
Ophiocordyceps subramaniannii Hirsu2|2084

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4815
MIPSSRLPRCLFLGRARISSRNLGIGVAPRLRASAWPQSSSLQAPTLSLVPCLTSTGFSTTAVLAKENPKGKGAN
FFDSAVDSSARPPSDEEAKDKKDVQEKNEADPKPASSEPAASAKTESGNAGRDSKAAGSSAGANPGSADSGSSGD
GGKRGRKPSEKSLQKPTVPEEYPQVLAVPMARRPLFPGFYKAITIKNPEVAAAISDSIKRGQQYVGAFMFKDENR
DGDVIHDVNEVHDVGVFAQITSAFPINGNELGLTAILYPHRRIRISSLLTAPEDPDAKKTDAKGADSKGTDAQAD
VQELQDADVKDTDAKTEVEVPRPIPSKPAEMDSQLDKKGDVVASFEEGAVERKSETVREKYDPTAFLRKYKVSVV
SVENVPEEPVDPKSPNIRALATEIINVFKEVALINTLFRDQITTFSISQFNGNVVSEPGKLADFAAAVSAGEPAD
LQEILGSMDVEDRMHKALIVLKNELMNARLQNKINKEVENRITKKQREYWLVEQLKGIRRELGIDTDGREKLIEK
FKERADKLAMPEEVRKVFDEEVNKLAHLEMAASEFNVTRNYLDWLTQVPWGQRSAENFGIAHAIKVLDEDHYGLK
DVKDRILEFIAVGKLRGTVEGKILCFVGPPGVGKTSIGKSIARALNRQYYRFSVGGLTDVSEIKGHRRTYVGALP
GRIIQALKKCQTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNSSFLDHYMDVPVDLSKVLFVCTANMTDTI
PQPLLDRMELITLSGYVADEKKAIADKYLGPAAKELAGLKDADVQLTEEAITELIKSYCRESGVRNLKKQIEKVY
RKSALKIVQELGEEVLPEEEALTEEGKAAQQESEKKHEAETADGEEAKTTVSGTETTEKPRKSLKVPDSVHVEIG
KGNLNDYVGPPKFTSDRLYDVSPSGVSMGLAWTQMGGAAMYIESILQAPLRPSTRPSLEITGNLQSVMKESTTIA
YSVAKAFMARTFPDNHFFDKAKVHLHVPDGAVPKDGPSAGITMATSLLSLAMDAPVDPTAAMTGELTLTGKVLRI
GGLREKTVAARRAGCKTMIFPADNMADWLELPQNIKEGIDGHAVAWYGEVFDLVFPSLDREQANKCKICEWKSQQ
PNKGAAAAHEQSPKNE*
Coding >Ophun1|4815
ATGATTCCGTCATCTCGCCTTCCCAGATGCTTGTTTCTGGGTCGCGCCAGGATATCCAGTCGAAATCTCGGCATT
GGCGTTGCGCCTCGACTCAGGGCGTCGGCGTGGCCGCAGTCTTCGTCTCTGCAGGCCCCTACTCTCTCACTAGTA
CCTTGTCTGACCTCGACCGGCTTCTCGACGACTGCTGTCCTCGCTAAAGAGAACCCCAAGGGCAAGGGCGCAAAC
TTCTTCGACTCTGCCGTCGATTCCTCCGCTCGCCCGCCCTCGGATGAAGAGGCCAAGGACAAAAAAGATGTCCAG
GAAAAGAACGAGGCCGATCCCAAGCCGGCCAGCTCCGAACCCGCAGCGTCGGCAAAGACCGAGTCGGGCAATGCT
GGACGAGACAGCAAGGCGGCAGGCAGTTCGGCTGGCGCGAACCCCGGATCGGCGGATAGCGGATCCAGCGGCGAC
GGAGGGAAACGGGGTCGCAAGCCTTCTGAGAAATCACTGCAGAAGCCCACTGTCCCGGAAGAGTATCCGCAAGTG
CTCGCGGTACCGATGGCTAGGAGACCGCTGTTCCCCGGGTTCTACAAGGCCATCACCATTAAGAATCCAGAGGTC
GCAGCCGCCATCAGCGACTCCATCAAGCGCGGCCAGCAATACGTTGGCGCCTTCATGTTCAAGGACGAAAACAGG
GACGGAGACGTCATTCACGATGTCAATGAAGTTCACGATGTCGGCGTCTTCGCGCAAATCACCAGCGCGTTTCCC
ATCAACGGCAACGAGCTTGGCCTGACAGCCATCCTCTATCCCCATCGCCGAATTCGAATCTCTAGCCTCCTCACA
GCACCTGAAGATCCAGACGCAAAGAAAACAGACGCCAAGGGAGCAGACAGCAAGGGCACAGATGCCCAGGCAGAT
GTCCAGGAACTCCAAGACGCAGACGTCAAGGATACGGATGCCAAGACCGAGGTCGAGGTACCGCGGCCGATACCG
TCCAAGCCGGCTGAAATGGACTCACAGCTGGACAAGAAAGGAGACGTCGTCGCCAGCTTCGAAGAAGGGGCCGTC
GAGCGCAAGTCAGAGACGGTCAGAGAAAAATACGATCCCACGGCGTTCCTCAGGAAGTACAAAGTCAGCGTCGTC
AGTGTCGAGAATGTGCCTGAGGAACCTGTCGATCCCAAGAGCCCCAACATCCGGGCCCTTGCCACCGAAATCATC
AATGTCTTCAAGGAAGTCGCCTTGATCAATACACTCTTCCGAGATCAGATTACCACCTTTTCCATCAGTCAGTTC
AATGGCAACGTCGTCTCCGAGCCGGGGAAACTGGCCGATTTCGCTGCAGCCGTTTCGGCCGGAGAGCCAGCCGAC
CTGCAGGAGATTCTGGGGTCCATGGACGTCGAGGACAGGATGCACAAGGCCCTGATTGTACTCAAGAACGAACTG
ATGAATGCCAGGCTGCAGAACAAGATCAACAAGGAAGTGGAGAATCGCATCACCAAGAAGCAGCGCGAATACTGG
CTCGTTGAGCAGCTCAAGGGCATCCGTCGCGAGCTCGGCATCGACACCGACGGCAGGGAGAAGCTCATCGAGAAG
TTCAAGGAAAGGGCCGACAAGCTGGCCATGCCCGAGGAGGTCCGCAAGGTCTTTGATGAGGAGGTTAACAAGCTC
GCTCATCTGGAGATGGCGGCGTCCGAGTTCAACGTGACGCGAAACTACCTCGACTGGCTGACTCAAGTGCCATGG
GGGCAGAGGAGCGCAGAGAACTTTGGTATAGCCCACGCGATCAAGGTGCTGGACGAGGATCACTACGGGCTCAAG
GACGTCAAGGACCGCATCCTCGAGTTCATCGCCGTCGGCAAGTTGCGAGGCACCGTCGAGGGCAAGATCCTCTGC
TTCGTCGGGCCCCCGGGAGTGGGAAAGACGAGCATCGGCAAGTCCATAGCCAGGGCCCTGAACCGACAATACTAC
CGGTTCAGCGTTGGGGGGCTCACCGACGTTTCGGAAATCAAGGGCCACCGCAGGACCTATGTGGGCGCGCTGCCT
GGACGCATCATCCAGGCGCTCAAGAAGTGTCAGACGGAGAATCCGCTCATCCTCATCGACGAGGTGGACAAGATC
GGCCGGGGCTATCAGGGCGACCCGTCCTCGGCGTTGCTGGAGCTGCTCGACCCCGAGCAGAACAGCTCGTTCCTG
GATCACTACATGGATGTCCCCGTCGATCTCTCCAAGGTTCTGTTCGTGTGCACGGCCAATATGACGGATACGATC
CCCCAGCCGCTCCTGGACCGCATGGAGCTAATCACGCTCTCGGGCTACGTGGCGGACGAGAAAAAGGCCATTGCC
GACAAGTATCTGGGCCCTGCAGCCAAAGAATTGGCCGGCCTCAAGGACGCGGACGTGCAGCTGACGGAGGAGGCC
ATCACGGAGCTAATCAAGTCGTACTGCCGCGAATCGGGCGTGCGCAACCTCAAGAAGCAGATCGAAAAGGTGTAC
CGGAAATCCGCGCTCAAGATTGTGCAGGAGCTCGGAGAAGAGGTGCTCCCGGAGGAGGAGGCCCTGACAGAAGAG
GGCAAGGCGGCTCAGCAAGAGTCGGAGAAGAAGCACGAGGCGGAGACGGCAGATGGAGAGGAGGCGAAGACGACG
GTCAGCGGCACGGAGACGACGGAGAAGCCACGGAAATCTCTCAAGGTGCCAGACTCGGTACACGTCGAGATTGGC
AAGGGGAACCTAAACGACTACGTCGGGCCGCCAAAGTTCACATCAGACCGGCTCTACGACGTCAGCCCATCGGGC
GTATCGATGGGCCTGGCGTGGACGCAGATGGGGGGCGCAGCCATGTACATCGAATCCATCCTCCAGGCGCCCCTG
CGGCCAAGCACTAGGCCGAGTCTGGAGATTACGGGCAACCTCCAGTCGGTGATGAAGGAGTCGACGACGATTGCC
TATTCGGTGGCCAAGGCTTTCATGGCCAGGACGTTTCCGGACAACCACTTCTTCGACAAGGCCAAGGTGCACCTT
CACGTGCCGGACGGAGCGGTGCCCAAGGACGGGCCGTCAGCCGGCATCACCATGGCGACGTCTCTCCTCTCGCTG
GCCATGGACGCTCCCGTGGATCCGACGGCGGCCATGACGGGCGAGCTGACGCTGACGGGCAAGGTGCTGCGCATC
GGCGGCCTACGGGAGAAGACGGTGGCGGCCAGACGAGCCGGTTGCAAGACGATGATCTTTCCGGCCGACAACATG
GCCGACTGGCTGGAGCTGCCGCAGAACATCAAAGAGGGCATCGACGGTCACGCGGTGGCATGGTATGGCGAGGTG
TTTGACCTCGTGTTCCCCAGCTTGGATCGCGAACAGGCCAACAAGTGTAAGATTTGCGAGTGGAAGAGCCAACAA
CCCAACAAGGGGGCTGCGGCGGCACACGAGCAGTCGCCAAAGAACGAATAG
Transcript >Ophun1|4815
ATGATTCCGTCATCTCGCCTTCCCAGATGCTTGTTTCTGGGTCGCGCCAGGATATCCAGTCGAAATCTCGGCATT
GGCGTTGCGCCTCGACTCAGGGCGTCGGCGTGGCCGCAGTCTTCGTCTCTGCAGGCCCCTACTCTCTCACTAGTA
CCTTGTCTGACCTCGACCGGCTTCTCGACGACTGCTGTCCTCGCTAAAGAGAACCCCAAGGGCAAGGGCGCAAAC
TTCTTCGACTCTGCCGTCGATTCCTCCGCTCGCCCGCCCTCGGATGAAGAGGCCAAGGACAAAAAAGATGTCCAG
GAAAAGAACGAGGCCGATCCCAAGCCGGCCAGCTCCGAACCCGCAGCGTCGGCAAAGACCGAGTCGGGCAATGCT
GGACGAGACAGCAAGGCGGCAGGCAGTTCGGCTGGCGCGAACCCCGGATCGGCGGATAGCGGATCCAGCGGCGAC
GGAGGGAAACGGGGTCGCAAGCCTTCTGAGAAATCACTGCAGAAGCCCACTGTCCCGGAAGAGTATCCGCAAGTG
CTCGCGGTACCGATGGCTAGGAGACCGCTGTTCCCCGGGTTCTACAAGGCCATCACCATTAAGAATCCAGAGGTC
GCAGCCGCCATCAGCGACTCCATCAAGCGCGGCCAGCAATACGTTGGCGCCTTCATGTTCAAGGACGAAAACAGG
GACGGAGACGTCATTCACGATGTCAATGAAGTTCACGATGTCGGCGTCTTCGCGCAAATCACCAGCGCGTTTCCC
ATCAACGGCAACGAGCTTGGCCTGACAGCCATCCTCTATCCCCATCGCCGAATTCGAATCTCTAGCCTCCTCACA
GCACCTGAAGATCCAGACGCAAAGAAAACAGACGCCAAGGGAGCAGACAGCAAGGGCACAGATGCCCAGGCAGAT
GTCCAGGAACTCCAAGACGCAGACGTCAAGGATACGGATGCCAAGACCGAGGTCGAGGTACCGCGGCCGATACCG
TCCAAGCCGGCTGAAATGGACTCACAGCTGGACAAGAAAGGAGACGTCGTCGCCAGCTTCGAAGAAGGGGCCGTC
GAGCGCAAGTCAGAGACGGTCAGAGAAAAATACGATCCCACGGCGTTCCTCAGGAAGTACAAAGTCAGCGTCGTC
AGTGTCGAGAATGTGCCTGAGGAACCTGTCGATCCCAAGAGCCCCAACATCCGGGCCCTTGCCACCGAAATCATC
AATGTCTTCAAGGAAGTCGCCTTGATCAATACACTCTTCCGAGATCAGATTACCACCTTTTCCATCAGTCAGTTC
AATGGCAACGTCGTCTCCGAGCCGGGGAAACTGGCCGATTTCGCTGCAGCCGTTTCGGCCGGAGAGCCAGCCGAC
CTGCAGGAGATTCTGGGGTCCATGGACGTCGAGGACAGGATGCACAAGGCCCTGATTGTACTCAAGAACGAACTG
ATGAATGCCAGGCTGCAGAACAAGATCAACAAGGAAGTGGAGAATCGCATCACCAAGAAGCAGCGCGAATACTGG
CTCGTTGAGCAGCTCAAGGGCATCCGTCGCGAGCTCGGCATCGACACCGACGGCAGGGAGAAGCTCATCGAGAAG
TTCAAGGAAAGGGCCGACAAGCTGGCCATGCCCGAGGAGGTCCGCAAGGTCTTTGATGAGGAGGTTAACAAGCTC
GCTCATCTGGAGATGGCGGCGTCCGAGTTCAACGTGACGCGAAACTACCTCGACTGGCTGACTCAAGTGCCATGG
GGGCAGAGGAGCGCAGAGAACTTTGGTATAGCCCACGCGATCAAGGTGCTGGACGAGGATCACTACGGGCTCAAG
GACGTCAAGGACCGCATCCTCGAGTTCATCGCCGTCGGCAAGTTGCGAGGCACCGTCGAGGGCAAGATCCTCTGC
TTCGTCGGGCCCCCGGGAGTGGGAAAGACGAGCATCGGCAAGTCCATAGCCAGGGCCCTGAACCGACAATACTAC
CGGTTCAGCGTTGGGGGGCTCACCGACGTTTCGGAAATCAAGGGCCACCGCAGGACCTATGTGGGCGCGCTGCCT
GGACGCATCATCCAGGCGCTCAAGAAGTGTCAGACGGAGAATCCGCTCATCCTCATCGACGAGGTGGACAAGATC
GGCCGGGGCTATCAGGGCGACCCGTCCTCGGCGTTGCTGGAGCTGCTCGACCCCGAGCAGAACAGCTCGTTCCTG
GATCACTACATGGATGTCCCCGTCGATCTCTCCAAGGTTCTGTTCGTGTGCACGGCCAATATGACGGATACGATC
CCCCAGCCGCTCCTGGACCGCATGGAGCTAATCACGCTCTCGGGCTACGTGGCGGACGAGAAAAAGGCCATTGCC
GACAAGTATCTGGGCCCTGCAGCCAAAGAATTGGCCGGCCTCAAGGACGCGGACGTGCAGCTGACGGAGGAGGCC
ATCACGGAGCTAATCAAGTCGTACTGCCGCGAATCGGGCGTGCGCAACCTCAAGAAGCAGATCGAAAAGGTGTAC
CGGAAATCCGCGCTCAAGATTGTGCAGGAGCTCGGAGAAGAGGTGCTCCCGGAGGAGGAGGCCCTGACAGAAGAG
GGCAAGGCGGCTCAGCAAGAGTCGGAGAAGAAGCACGAGGCGGAGACGGCAGATGGAGAGGAGGCGAAGACGACG
GTCAGCGGCACGGAGACGACGGAGAAGCCACGGAAATCTCTCAAGGTGCCAGACTCGGTACACGTCGAGATTGGC
AAGGGGAACCTAAACGACTACGTCGGGCCGCCAAAGTTCACATCAGACCGGCTCTACGACGTCAGCCCATCGGGC
GTATCGATGGGCCTGGCGTGGACGCAGATGGGGGGCGCAGCCATGTACATCGAATCCATCCTCCAGGCGCCCCTG
CGGCCAAGCACTAGGCCGAGTCTGGAGATTACGGGCAACCTCCAGTCGGTGATGAAGGAGTCGACGACGATTGCC
TATTCGGTGGCCAAGGCTTTCATGGCCAGGACGTTTCCGGACAACCACTTCTTCGACAAGGCCAAGGTGCACCTT
CACGTGCCGGACGGAGCGGTGCCCAAGGACGGGCCGTCAGCCGGCATCACCATGGCGACGTCTCTCCTCTCGCTG
GCCATGGACGCTCCCGTGGATCCGACGGCGGCCATGACGGGCGAGCTGACGCTGACGGGCAAGGTGCTGCGCATC
GGCGGCCTACGGGAGAAGACGGTGGCGGCCAGACGAGCCGGTTGCAAGACGATGATCTTTCCGGCCGACAACATG
GCCGACTGGCTGGAGCTGCCGCAGAACATCAAAGAGGGCATCGACGGTCACGCGGTGGCATGGTATGGCGAGGTG
TTTGACCTCGTGTTCCCCAGCTTGGATCGCGAACAGGCCAACAAGTGTAAGATTTGCGAGTGGAAGAGCCAACAA
CCCAACAAGGGGGCTGCGGCGGCACACGAGCAGTCGCCAAAGAACGAATAG
Gene >Ophun1|4815
ATGATTCCGTCATCTCGCCTTCCCAGATGCTTGTTTCTGGGTCGCGCCAGGATATCCAGTCGAAATCTCGGCATT
GGCGTTGCGCCTCGACTCAGGGCGTCGGCGTGGCCGCAGTCTTCGTCTCTGCAGGCCCCTACTCTCTCACTAGTA
CCTTGTCTGACCTCGACCGGCTTCTCGACGACTGCTGTCCTCGCTAAAGAGAACCCCAAGGGCAAGGGCGCAAAC
TTCTTCGACTCTGCCGTCGATTCCTCCGCTCGCCCGCCCTCGGATGAAGAGGCCAAGGACAAAAAAGATGTCCAG
GAAAAGAACGAGGCCGATCCCAAGCCGGCCAGCTCCGAACCCGCAGCGTCGGCAAAGACCGAGTCGGGCAATGCT
GGACGAGACAGCAAGGCGGCAGGCAGTTCGGCTGGCGCGAACCCCGGATCGGCGGATAGCGGATCCAGCGGCGAC
GGAGGGAAACGGGGTCGCAAGCCTTCTGAGAAATCACTGCAGAAGCCCACTGTCCCGGAAGAGTATCCGCAAGTG
CTCGCGGTACCGATGGCTAGGAGACCGCTGTTCCCCGGGTTCTACAAGGCCATCACCATTAAGAATCCAGAGGTC
GCAGCCGCCATCAGCGACTCCATCAAGCGCGGCCAGCAATACGTTGGCGCCTTCATGTTCAAGGACGAAAACAGG
GACGGAGACGTCATTCACGATGTCAATGAAGTTCACGATGTCGGCGTCTTCGCGCAAATCACCAGCGCGTTTCCC
ATCAACGGCAACGAGCTTGGCCTGACAGCCATCCTCTATCCCCATCGCCGAATTCGAATCTCTAGCCTCCTCACA
GCACCTGAAGATCCAGACGCAAAGAAAACAGACGCCAAGGGAGCAGACAGCAAGGGCACAGATGCCCAGGCAGAT
GTCCAGGAACTCCAAGACGCAGACGTCAAGGATACGGATGCCAAGACCGAGGTCGAGGTACCGCGGCCGATACCG
TCCAAGCCGGCTGAAATGGACTCACAGCTGGACAAGAAAGGAGACGTCGTCGCCAGCTTCGAAGAAGGGGCCGTC
GAGCGCAAGTCAGAGACGGTCAGAGAAAAATACGATCCCACGGCGTTCCTCAGGAAGTACAAAGTCAGCGTCGTC
AGTGTCGAGAATGTGCCTGAGGAACCTGTCGATCCCAAGAGCCCCAACATCCGGGCCCTTGCCACCGAAATCATC
AATGTCTTCAAGGAAGTCGCCTTGATCAATACACTCTTCCGAGATCAGATTACCACCTTTTCCATCAGTCAGTTC
AATGGCAACGTCGTCTCCGAGCCGGGGAAACTGGCCGATTTCGCTGCAGCCGTTTCGGCCGGAGAGCCAGCCGAC
CTGCAGGAGATTCTGGGGTCCATGGACGTCGAGGACAGGATGCACAAGGCCCTGATTGTACTCAAGAACGAACTG
ATGAATGCCAGGCTGCAGAACAAGATCAACAAGGAAGTGGAGAATCGCATCACCAAGAAGCAGCGCGAATACTGG
CTCGTTGAGCAGCTCAAGGGCATCCGTCGCGAGCTCGGCATCGACACCGACGGCAGGGAGAAGCTCATCGAGAAG
TTCAAGGAAAGGGCCGACAAGCTGGCCATGCCCGAGGAGGTCCGCAAGGTCTTTGATGAGGAGGTTAACAAGCTC
GCTCATCTGGAGATGGCGGCGTCCGAGTTCAACGTGACGCGAAACTACCTCGACTGGCTGACTCAAGTGCCATGG
GGGCAGAGGAGCGCAGAGAACTTTGGTATAGCCCACGCGATCAAGGTGCTGGACGAGGATCACTACGGGCTCAAG
GACGTCAAGGACCGCATCCTCGAGTTCATCGCCGTCGGCAAGTTGCGAGGCACCGTCGAGGGCAAGATCCTCTGC
TTCGTCGGGCCCCCGGGAGTGGGAAAGACGAGCATCGGCAAGTCCATAGCCAGGGCCCTGAACCGACAATACTAC
CGGTTCAGCGTTGGGGGGCTCACCGACGTTTCGGAAATCAAGGGCCACCGCAGGACCTATGTGGGCGCGCTGCCT
GGACGCATCATCCAGGCGCTCAAGAAGTGTCAGACGGAGAATCCGCTCATCCTCATCGACGAGGTGGACAAGATC
GGCCGGGGCTATCAGGGCGACCCGTCCTCGGCGTTGCTGGAGCTGCTCGACCCCGAGCAGAACAGCTCGTTCCTG
GATCACTACATGGATGTCCCCGTCGATCTCTCCAAGGTTCTGTTCGTGTGCACGGCCAATATGACGGATACGATC
CCCCAGCCGCTCCTGGACCGCATGGAGCTAATCACGCTCTCGGGCTACGTGGCGGACGAGAAAAAGGCCATTGCC
GACAAGTATCTGGGCCCTGCAGCCAAAGAATTGGCCGGCCTCAAGGACGCGGACGTGCAGCTGACGGAGGAGGCC
ATCACGGAGCTAATCAAGTCGTACTGCCGCGAATCGGGCGTGCGCAACCTCAAGAAGCAGATCGAAAAGGTGTAC
CGGAAATCCGCGCTCAAGATTGTGCAGGAGCTCGGAGAAGAGGTGCTCCCGGAGGAGGAGGCCCTGACAGAAGAG
GGCAAGGCGGCTCAGCAAGAGTCGGAGAAGAAGCACGAGGCGGAGACGGCAGATGGAGAGGAGGCGAAGACGACG
GTCAGCGGCACGGAGACGACGGAGAAGCCACGGAAATCTCTCAAGGTGCCAGACTCGGTACACGTCGAGATTGGC
AAGGGGAACCTAAACGACTACGTCGGGCCGCCAAAGTTCACATCAGACCGGCTCTACGACGTCAGCCCATCGGGC
GTATCGATGGGCCTGGCGTGGACGCAGATGGGGGGCGCAGCCATGTACATCGAATCCATCCTCCAGGCGCCCCTG
CGGCCAAGCACTAGGCCGAGTCTGGAGATTACGGGCAACCTCCAGTCGGTGATGAAGGAGTCGACGACGATTGCC
TATTCGGTGGCCAAGGCTTTCATGGCCAGGACGTTTCCGGACAACCACTTCTTCGACAAGGCCAAGGTGCACCTT
CACGTGCCGGACGGAGCGGTGCCCAAGGACGGGCCGTCAGCCGGCATCACCATGGCGACGTCTCTCCTCTCGCTG
GCCATGGACGCTCCCGTGGATCCGACGGCGGCCATGACGGGCGAGCTGACGCTGACGGGCAAGGTGCTGCGCATC
GGCGGCCTACGGGAGAAGACGGTGGCGGCCAGACGAGCCGGTTGCAAGACGATGATCTTTCCGGCCGACAACATG
GCCGACTGGCTGGAGCTGCCGCAGGTTTGTGACATTGTTGTTCCCACCACGGTTGTCTCTTGACTGACGGGTTGC
AGAACATCAAAGAGGGCATCGACGGTCACGCGGTGGCATGGTATGGCGAGGTGTTTGACCTCGTGTTCCCCAGCT
TGGATCGCGAACAGGCCAACAAGTGTAAGATTTGCGAGTGGAAGAGCCAACAACCCAACAAGGGGGCTGCGGCGG
CACACGAGCAGTCGCCAAAGAACGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail