Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4815
Gene name
LocationContig_453:654..4133
Strand-
Gene length (bp)3479
Transcript length (bp)3426
Coding sequence length (bp)3426
Protein length (aa) 1142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05362 Lon_C Lon protease (S16) C-terminal proteolytic domain 2.4E-64 899 1104
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 2.5E-30 175 472
PF00004 AAA ATPase family associated with various cellular activities (AAA) 5.9E-21 624 761
PF13541 ChlI Subunit ChlI of Mg-chelatase 2.8E-07 955 1074
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.4E-06 624 757

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8C4|LONM_NEUCR Lon protease homolog, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pim1 PE=3 SV=1 157 1119 0.0E+00
sp|A2QCJ2|LONM_ASPNC Lon protease homolog, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pim1 PE=3 SV=1 31 1135 0.0E+00
sp|Q4X0Z7|LONM_ASPFU Lon protease homolog, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pim1 PE=3 SV=1 76 1129 0.0E+00
sp|Q5AZT7|LONM_EMENI Lon protease homolog, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pim1 PE=3 SV=1 162 1124 0.0E+00
sp|P36775|LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIM1 PE=1 SV=2 164 1124 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8C4|LONM_NEUCR Lon protease homolog, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pim1 PE=3 SV=1 157 1119 0.0E+00
sp|A2QCJ2|LONM_ASPNC Lon protease homolog, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pim1 PE=3 SV=1 31 1135 0.0E+00
sp|Q4X0Z7|LONM_ASPFU Lon protease homolog, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pim1 PE=3 SV=1 76 1129 0.0E+00
sp|Q5AZT7|LONM_EMENI Lon protease homolog, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pim1 PE=3 SV=1 162 1124 0.0E+00
sp|P36775|LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIM1 PE=1 SV=2 164 1124 0.0E+00
sp|Q6CNR9|LONM_KLULA Lon protease homolog, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PIM1 PE=3 SV=1 86 1114 0.0E+00
sp|Q6FPE6|LONM_CANGA Lon protease homolog, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PIM1 PE=3 SV=1 145 1124 0.0E+00
sp|Q09769|LONM_SCHPO Lon protease homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=3 SV=1 165 1140 0.0E+00
sp|Q754Q9|LONM_ASHGO Lon protease homolog, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PIM1 PE=3 SV=2 168 1124 0.0E+00
sp|P0CQ17|LONM_CRYNB Lon protease homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PIM1 PE=3 SV=1 87 1090 0.0E+00
sp|P0CQ16|LONM_CRYNJ Lon protease homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PIM1 PE=3 SV=1 87 1090 0.0E+00
sp|Q6C0B5|LONM_YARLI Lon protease homolog, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PIM1 PE=3 SV=1 164 1124 0.0E+00
sp|Q924S5|LONM_RAT Lon protease homolog, mitochondrial OS=Rattus norvegicus GN=Lonp1 PE=2 SV=1 111 1113 0.0E+00
sp|Q8CGK3|LONM_MOUSE Lon protease homolog, mitochondrial OS=Mus musculus GN=Lonp1 PE=1 SV=2 128 1113 0.0E+00
sp|P36776|LONM_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens GN=LONP1 PE=1 SV=2 371 1106 0.0E+00
sp|P93655|LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana GN=LON1 PE=1 SV=2 375 1105 0.0E+00
sp|P93648|LONM_MAIZE Lon protease homolog, mitochondrial OS=Zea mays GN=LON2 PE=1 SV=1 375 1107 0.0E+00
sp|O44952|LONM_CAEEL Lon protease homolog, mitochondrial OS=Caenorhabditis elegans GN=C34B2.6 PE=3 SV=1 168 1105 0.0E+00
sp|Q59HJ6|LONM_BOVIN Lon protease homolog, mitochondrial OS=Bos taurus GN=LONP1 PE=1 SV=1 371 1106 0.0E+00
sp|A2YQ56|LONM_ORYSI Lon protease homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_27415 PE=2 SV=1 375 1107 0.0E+00
sp|Q69UZ3|LONM_ORYSJ Lon protease homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0689300 PE=2 SV=1 375 1107 0.0E+00
sp|Q00WL5|LONM_OSTTA Lon protease homolog, mitochondrial OS=Ostreococcus tauri GN=Ot13g03040 PE=3 SV=2 374 1101 0.0E+00
sp|A8XFM8|LONM_CAEBR Lon protease homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG12802 PE=3 SV=3 372 1105 0.0E+00
sp|Q6ME13|LON_PARUW Lon protease OS=Protochlamydia amoebophila (strain UWE25) GN=lon PE=3 SV=1 363 1116 0.0E+00
sp|Q7KUT2|LONM_DROME Lon protease homolog, mitochondrial OS=Drosophila melanogaster GN=Lon PE=1 SV=1 168 1137 0.0E+00
sp|Q9M9L7|LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=LON4 PE=3 SV=1 352 1105 0.0E+00
sp|B7FSL4|LONM_PHATC Lon protease homolog, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_18202 PE=3 SV=1 391 1109 0.0E+00
sp|O84348|LON_CHLTR Lon protease OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lon PE=3 SV=1 392 1108 0.0E+00
sp|Q9PK50|LON_CHLMU Lon protease OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lon PE=3 SV=1 392 1108 0.0E+00
sp|Q3A701|LON1_PELCD Lon protease 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lon1 PE=3 SV=1 389 1105 0.0E+00
sp|Q6BKJ4|LONM_DEBHA Lon protease homolog, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PIM1 PE=3 SV=2 363 1124 0.0E+00
sp|Q9Z9F4|LON_CHLPN Lon protease OS=Chlamydia pneumoniae GN=lon PE=3 SV=1 392 1108 0.0E+00
sp|A3M072|LONM_PICST Lon protease homolog, mitochondrial (Fragment) OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PIM1 PE=3 SV=3 351 1124 0.0E+00
sp|Q9M9L8|LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana GN=LON3 PE=3 SV=1 375 1105 0.0E+00
sp|A0L516|LON_MAGMM Lon protease OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lon PE=3 SV=1 372 1105 0.0E+00
sp|Q5A6N1|LONM_CANAL Lon protease homolog, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIM1 PE=3 SV=1 353 1124 0.0E+00
sp|Q31FD3|LON2_THICR Lon protease 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=lon2 PE=3 SV=2 379 1105 0.0E+00
sp|B9WLN5|LONM_CANDC Lon protease homolog, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PIM1 PE=3 SV=1 364 1124 0.0E+00
sp|Q550C8|LONM2_DICDI Lon protease homolog, mitochondrial 2 OS=Dictyostelium discoideum GN=DDB_0217928 PE=3 SV=1 436 1105 0.0E+00
sp|Q1IPZ8|LON_KORVE Lon protease OS=Koribacter versatilis (strain Ellin345) GN=lon PE=3 SV=1 376 1107 0.0E+00
sp|Q54YV4|LONM1_DICDI Lon protease homolog, mitochondrial 1 OS=Dictyostelium discoideum GN=DDB_G0278063 PE=3 SV=3 374 1107 0.0E+00
sp|B5RL78|LON_BORDL Lon protease OS=Borrelia duttonii (strain Ly) GN=lon PE=3 SV=1 374 1105 8.0E-174
sp|A4S6Y4|LONM_OSTLU Lon protease homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_41620 PE=3 SV=1 374 834 2.0E-172
sp|A8ZX50|LON_DESOH Lon protease OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lon PE=3 SV=1 394 1105 2.0E-170
sp|Q59185|LON1_BORBU Lon protease 1 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lon1 PE=3 SV=1 424 1105 9.0E-170
sp|A4XJL4|LON_CALS8 Lon protease OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lon PE=3 SV=1 374 1103 2.0E-169
sp|B5EDX8|LON_GEOBB Lon protease OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lon PE=3 SV=1 428 1101 4.0E-167
sp|Q2LVS9|LON_SYNAS Lon protease OS=Syntrophus aciditrophicus (strain SB) GN=lon PE=3 SV=1 388 1105 1.0E-166
sp|A0RJ87|LON_BACAH Lon protease OS=Bacillus thuringiensis (strain Al Hakam) GN=lon PE=3 SV=1 377 1102 6.0E-166
sp|O69177|LON_RHIME Lon protease OS=Rhizobium meliloti (strain 1021) GN=lon PE=3 SV=2 350 1101 9.0E-165
sp|B8G736|LON_CHLAD Lon protease OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=lon PE=3 SV=1 430 1105 3.0E-164
sp|O66605|LON_AQUAE Lon protease OS=Aquifex aeolicus (strain VF5) GN=lon PE=1 SV=1 430 1105 3.0E-164
sp|A4J7L6|LON_DESRM Lon protease OS=Desulfotomaculum reducens (strain MI-1) GN=lon PE=3 SV=1 430 1120 6.0E-164
sp|P36772|LON_BRECH Lon protease OS=Brevibacillus choshinensis GN=lon PE=3 SV=1 430 1101 1.0E-162
sp|A7NM80|LON_ROSCS Lon protease OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=lon PE=3 SV=1 389 1105 1.0E-161
sp|P0C113|LON_BRUAB Lon protease OS=Brucella abortus biovar 1 (strain 9-941) GN=lon PE=3 SV=1 392 1101 1.0E-161
sp|Q2YPX3|LON_BRUA2 Lon protease OS=Brucella abortus (strain 2308) GN=lon PE=2 SV=1 392 1101 1.0E-161
sp|Q8G0I7|LON_BRUSU Lon protease OS=Brucella suis biovar 1 (strain 1330) GN=lon PE=3 SV=1 392 1101 2.0E-161
sp|Q8YHC6|LON_BRUME Lon protease OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lon PE=3 SV=2 392 1101 2.0E-161
sp|Q5H432|LON_XANOR Lon protease OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lon PE=3 SV=1 383 1105 8.0E-161
sp|Q1MS21|LON_LAWIP Lon protease OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lon PE=3 SV=1 430 1105 9.0E-161
sp|P37945|LON1_BACSU Lon protease 1 OS=Bacillus subtilis (strain 168) GN=lon1 PE=1 SV=1 430 1102 1.0E-160
sp|B5YFG2|LON_DICT6 Lon protease OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=lon PE=3 SV=1 380 1105 1.0E-160
sp|A9B3R2|LON2_HERA2 Lon protease 2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=lon2 PE=3 SV=1 436 1107 3.0E-160
sp|Q72KS4|LON1_THET2 Lon protease 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lon1 PE=3 SV=1 378 1101 1.0E-158
sp|P57549|LON_BUCAI Lon protease OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lon PE=3 SV=1 428 1103 7.0E-158
sp|B8J198|LON_DESDA Lon protease OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=lon PE=3 SV=1 430 1105 2.0E-157
sp|Q72JM6|LON2_THET2 Lon protease 2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lon2 PE=3 SV=1 378 1105 6.0E-157
sp|Q39QP7|LON_GEOMG Lon protease OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lon PE=3 SV=1 430 1085 7.0E-157
sp|B8EMF2|LON_METSB Lon protease OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lon PE=3 SV=1 359 1102 8.0E-157
sp|A0LG61|LON2_SYNFM Lon protease 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lon2 PE=3 SV=1 377 1107 1.0E-156
sp|A9GBF1|LON2_SORC5 Lon protease 2 OS=Sorangium cellulosum (strain So ce56) GN=lon2 PE=3 SV=1 377 1124 1.0E-156
sp|B3E7K2|LON_GEOLS Lon protease OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=lon PE=3 SV=1 430 1105 1.0E-156
sp|Q2IIK1|LON_ANADE Lon protease OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lon PE=3 SV=1 391 1101 3.0E-156
sp|P0A9M0|LON_ECOLI Lon protease OS=Escherichia coli (strain K12) GN=lon PE=1 SV=1 421 1105 4.0E-156
sp|P0A9M1|LON_ECOL6 Lon protease OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lon PE=3 SV=1 421 1105 4.0E-156
sp|A6LD45|LON_PARD8 Lon protease OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lon PE=3 SV=1 414 1114 1.0E-155
sp|A9KH99|LON_CLOPH Lon protease OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lon PE=3 SV=1 450 1101 2.0E-155
sp|Q72CE6|LON_DESVH Lon protease OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lon PE=3 SV=1 452 1101 3.0E-155
sp|B2KCC0|LON_ELUMP Lon protease OS=Elusimicrobium minutum (strain Pei191) GN=lon PE=3 SV=1 384 1105 2.0E-154
sp|B3QSJ7|LON_CHLT3 Lon protease OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=lon PE=3 SV=1 436 1104 2.0E-154
sp|B1GZQ6|LON_UNCTG Lon protease OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=lon PE=3 SV=1 388 1108 4.0E-154
sp|Q0AWF3|LON_SYNWW Lon protease OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lon PE=3 SV=1 375 1109 5.0E-154
sp|P77810|LON_AZOBR Lon protease OS=Azospirillum brasilense GN=lon PE=2 SV=1 388 1132 9.0E-154
sp|P36774|LON2_MYXXA Lon protease 2 OS=Myxococcus xanthus GN=lon2 PE=1 SV=3 391 1101 1.0E-153
sp|Q32JJ5|LON_SHIDS Lon protease OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lon PE=3 SV=1 421 1094 2.0E-153
sp|A8HYF7|LON_AZOC5 Lon protease OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lon PE=3 SV=1 394 1101 2.0E-153
sp|A9WGB5|LON_CHLAA Lon protease OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=lon PE=3 SV=1 388 1082 1.0E-152
sp|Q89A99|LON_BUCBP Lon protease OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lon PE=3 SV=1 428 1103 2.0E-152
sp|B8CY71|LON_HALOH Lon protease OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=lon PE=3 SV=1 392 1105 3.0E-152
sp|Q3JBB6|LON_NITOC Lon protease OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lon PE=3 SV=1 464 1110 7.0E-152
sp|Q11QT1|LON_CYTH3 Lon protease OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lon PE=3 SV=1 423 1081 1.0E-151
sp|A8M1E8|LON_SALAI Lon protease OS=Salinispora arenicola (strain CNS-205) GN=lon PE=3 SV=1 435 1105 6.0E-151
sp|P43864|LON_HAEIN Lon protease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lon PE=3 SV=1 430 1101 7.0E-151
sp|P46067|LON_ERWAM Lon protease OS=Erwinia amylovora GN=lon PE=2 SV=1 428 1105 9.0E-151
sp|B5Y8Q8|LON_COPPD Lon protease OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=lon PE=3 SV=1 433 1105 2.0E-150
sp|Q026Q2|LON_SOLUE Lon protease OS=Solibacter usitatus (strain Ellin6076) GN=lon PE=3 SV=1 390 1111 2.0E-150
sp|Q8K988|LON_BUCAP Lon protease OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lon PE=3 SV=1 435 1105 9.0E-150
sp|B0TFI9|LON_HELMI Lon protease OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lon PE=3 SV=1 386 1089 1.0E-149
sp|A5EWF3|LON_DICNV Lon protease OS=Dichelobacter nodosus (strain VCS1703A) GN=lon PE=3 SV=1 430 1105 1.0E-149
sp|B3CLB3|LON_WOLPP Lon protease OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lon PE=3 SV=1 391 1090 2.0E-149
sp|Q9RXG4|LON_DEIRA Lon protease OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lon PE=3 SV=1 392 1105 2.0E-149
sp|Q31GE9|LON1_THICR Lon protease 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=lon1 PE=3 SV=1 430 1139 3.0E-149
sp|A5FG89|LON_FLAJ1 Lon protease OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lon PE=3 SV=1 376 1117 4.0E-149
sp|A9F8L0|LON4_SORC5 Lon protease 4 OS=Sorangium cellulosum (strain So ce56) GN=lon4 PE=3 SV=1 339 1086 8.0E-149
sp|A0LEE9|LON1_SYNFM Lon protease 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lon1 PE=3 SV=1 430 1111 1.0E-148
sp|B7GXS7|LON_ACIB3 Lon protease OS=Acinetobacter baumannii (strain AB307-0294) GN=lon PE=3 SV=1 452 1108 2.0E-147
sp|A7HK39|LON_FERNB Lon protease OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=lon PE=3 SV=1 430 1117 2.0E-147
sp|Q3A334|LON2_PELCD Lon protease 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lon2 PE=3 SV=1 430 1085 2.0E-146
sp|B2TFQ5|LON_BURPP Lon protease OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lon PE=3 SV=1 342 1082 3.0E-145
sp|P0CAW0|LON_CAUCR Lon protease OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lon PE=3 SV=1 430 1101 3.0E-144
sp|B8GX12|LON_CAUCN Lon protease OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lon PE=3 SV=1 430 1101 3.0E-144
sp|Q8RHK0|LON_FUSNN Lon protease OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lon PE=3 SV=1 412 1105 7.0E-144
sp|Q6MGP8|LON2_BDEBA Lon protease 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lon2 PE=3 SV=1 430 1105 2.0E-143
sp|A8F811|LON_PSELT Lon protease OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=lon PE=3 SV=1 430 1090 1.0E-142
sp|Q180E4|LON_PEPD6 Lon protease OS=Peptoclostridium difficile (strain 630) GN=lon PE=3 SV=2 430 1102 4.0E-142
sp|Q0J032|LONP2_ORYSJ Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. japonica GN=Os09g0533400 PE=2 SV=1 389 1105 1.0E-141
sp|B8BDV1|LONP2_ORYSI Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. indica GN=LON1 PE=2 SV=1 389 1105 3.0E-141
sp|P55995|LON_HELPY Lon protease OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lon PE=3 SV=1 381 1102 3.0E-141
sp|B0TZA7|LON_FRAP2 Lon protease OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=lon PE=3 SV=1 432 1105 3.0E-141
sp|Q5PQY6|LONP2_DANRE Lon protease homolog 2, peroxisomal OS=Danio rerio GN=lonp2 PE=2 SV=1 436 1107 9.0E-141
sp|B2RII6|LON_PORG3 Lon protease OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lon PE=3 SV=1 433 1101 2.0E-140
sp|Q9DBN5|LONP2_MOUSE Lon protease homolog 2, peroxisomal OS=Mus musculus GN=Lonp2 PE=1 SV=1 453 1105 4.0E-140
sp|A9B5N1|LON1_HERA2 Lon protease 1 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=lon1 PE=3 SV=1 398 1105 1.0E-139
sp|O04979|LONP2_SPIOL Lon protease homolog 2, peroxisomal OS=Spinacia oleracea PE=2 SV=2 435 1090 1.0E-139
sp|Q6AK61|LON2_DESPS Lon protease 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lon2 PE=3 SV=1 375 1102 1.0E-139
sp|Q3MIB4|LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus GN=Lonp2 PE=1 SV=2 453 1105 2.0E-139
sp|A9GIS9|LON3_SORC5 Lon protease 3 OS=Sorangium cellulosum (strain So ce56) GN=lon3 PE=3 SV=1 430 1085 3.0E-139
sp|O51558|LON2_BORBU Lon protease 2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lon2 PE=3 SV=2 428 1104 3.0E-139
sp|Q9ZJL3|LON_HELPJ Lon protease OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lon PE=3 SV=1 381 1102 4.0E-139
sp|A8Z5Z0|LON_SULMW Lon protease OS=Sulcia muelleri (strain GWSS) GN=lon PE=3 SV=1 399 1103 2.0E-138
sp|P93647|LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays GN=LON1 PE=2 SV=1 389 1105 4.0E-138
sp|Q86WA8|LONP2_HUMAN Lon protease homolog 2, peroxisomal OS=Homo sapiens GN=LONP2 PE=1 SV=1 453 1105 7.0E-138
sp|Q3SX23|LONP2_BOVIN Lon protease homolog 2, peroxisomal OS=Bos taurus GN=LONP2 PE=2 SV=1 534 1105 2.0E-137
sp|Q5R6M5|LONP2_PONAB Lon protease homolog 2, peroxisomal OS=Pongo abelii GN=LONP2 PE=2 SV=1 534 1105 7.0E-137
sp|B3ERM8|LON_AMOA5 Lon protease OS=Amoebophilus asiaticus (strain 5a2) GN=lon PE=3 SV=1 443 1133 1.0E-136
sp|Q6AS16|LON1_DESPS Lon protease 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lon1 PE=3 SV=1 357 828 2.0E-136
sp|Q2TAF8|LONP2_XENLA Lon protease homolog 2, peroxisomal OS=Xenopus laevis GN=lonp2 PE=2 SV=1 535 1105 3.0E-136
sp|Q2GE60|LON_NEOSM Lon protease OS=Neorickettsia sennetsu (strain Miyayama) GN=lon PE=3 SV=1 374 1089 4.0E-135
sp|O64948|LONP2_ARATH Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana GN=LON2 PE=2 SV=1 435 1085 6.0E-135
sp|A7ZEJ3|LON_CAMC1 Lon protease OS=Campylobacter concisus (strain 13826) GN=lon PE=3 SV=1 459 1101 9.0E-135
sp|O31147|LON_MYCSM Lon protease OS=Mycobacterium smegmatis GN=lon PE=1 SV=1 428 1090 2.0E-134
sp|Q1RID6|LON_RICBR Lon protease OS=Rickettsia bellii (strain RML369-C) GN=lon PE=3 SV=1 463 1102 3.0E-134
sp|A6LSV5|LON_CLOB8 Lon protease OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=lon PE=3 SV=1 434 1101 9.0E-134
sp|Q0RPW3|LON_FRAAA Lon protease OS=Frankia alni (strain ACN14a) GN=lon PE=3 SV=1 407 1116 3.0E-133
sp|Q2NEP8|LON_METST Lon protease OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=lon PE=3 SV=1 410 1101 5.0E-133
sp|Q92HZ1|LON_RICCN Lon protease OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lon PE=3 SV=2 378 1101 3.0E-132
sp|Q97FT9|LON_CLOAB Lon protease OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lon PE=3 SV=1 430 1086 2.0E-131
sp|B3CUN9|LON_ORITI Lon protease OS=Orientia tsutsugamushi (strain Ikeda) GN=lon PE=3 SV=1 449 1107 5.0E-130
sp|Q469F5|LON_METBF Lon protease OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lon PE=3 SV=1 449 1084 2.0E-129
sp|Q4ULN0|LON_RICFE Lon protease OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lon PE=3 SV=1 463 1101 2.0E-128
sp|Q8EV77|LON_MYCPE Lon protease OS=Mycoplasma penetrans (strain HF-2) GN=lon PE=3 SV=1 452 1105 9.0E-127
sp|Q6C0L7|LONP2_YARLI Lon protease homolog 2, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F23595g PE=3 SV=1 434 1105 1.0E-126
sp|O83536|LON_TREPA Lon protease OS=Treponema pallidum (strain Nichols) GN=lon PE=3 SV=1 392 833 5.0E-126
sp|Q600B5|LON_MYCH2 Lon protease OS=Mycoplasma hyopneumoniae (strain 232) GN=lon PE=3 SV=1 479 1105 2.0E-125
sp|Q2NJE3|LON_AYWBP Lon protease OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lon PE=3 SV=1 463 1105 4.0E-124
sp|P47481|LON_MYCGE Lon protease OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=lon PE=3 SV=1 479 1105 5.0E-124
sp|B1AIY7|LON_UREP2 Lon protease OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=lon PE=3 SV=1 392 1105 2.0E-123
sp|B2V6N0|LON_SULSY Lon protease OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=lon PE=3 SV=1 430 821 8.0E-122
sp|Q72UP9|LON_LEPIC Lon protease OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lon PE=3 SV=1 367 835 6.0E-121
sp|A5IYF2|LON_MYCAP Lon protease OS=Mycoplasma agalactiae (strain PG2) GN=lon PE=3 SV=1 476 1105 7.0E-120
sp|B3PN08|LON_MYCA5 Lon protease OS=Mycoplasma arthritidis (strain 158L3-1) GN=lon PE=3 SV=1 454 1105 1.0E-119
sp|B8F9K1|LON_DESAA Lon protease OS=Desulfatibacillum alkenivorans (strain AK-01) GN=lon PE=3 SV=1 430 834 6.0E-119
sp|A2RAF6|LONP2_ASPNC Lon protease homolog 2, peroxisomal OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g02980 PE=3 SV=1 430 1106 2.0E-118
sp|Q4WVD9|LONP2_ASPFU Lon protease homolog 2, peroxisomal OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_5G11750 PE=3 SV=1 523 1106 4.0E-114
sp|Q6ML73|LON1_BDEBA Lon protease 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lon1 PE=3 SV=1 436 847 3.0E-110
sp|B4RI01|LON_PHEZH Lon protease OS=Phenylobacterium zucineum (strain HLK1) GN=lon PE=3 SV=1 431 834 1.0E-107
sp|P74956|LON_VIBPA Lon protease OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lon PE=3 SV=2 422 833 4.0E-107
sp|P36773|LON1_MYXXA Lon protease 1 OS=Myxococcus xanthus GN=lon1 PE=2 SV=1 388 834 2.0E-104
sp|Q2V573|LONP2_PICAN Lon protease homolog 2, peroxisomal OS=Pichia angusta GN=PLN PE=3 SV=1 497 1080 4.0E-103
sp|Q7SA85|LONP2_NEUCR Lon protease homolog 2, peroxisomal OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08303 PE=3 SV=1 623 1106 1.0E-102
sp|A9ETZ9|LON1_SORC5 Lon protease 1 OS=Sorangium cellulosum (strain So ce56) GN=lon1 PE=3 SV=1 422 821 2.0E-98
sp|Q6MTF4|LON_MYCMS Lon protease OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lon PE=3 SV=1 478 904 6.0E-98
sp|B0S2N4|LON_FINM2 Lon protease OS=Finegoldia magna (strain ATCC 29328) GN=lon PE=3 SV=1 432 828 6.0E-98
sp|Q6CWS4|LONP2_KLULA Lon protease homolog 2, peroxisomal OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0B01892g PE=3 SV=1 541 1080 1.0E-95
sp|Q9ZD92|LON_RICPR Lon protease OS=Rickettsia prowazekii (strain Madrid E) GN=lon PE=3 SV=1 362 833 3.0E-94
sp|Q68WS8|LON_RICTY Lon protease OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lon PE=3 SV=1 378 833 7.0E-94
sp|Q755E4|LONP2_ASHGO Lon protease homolog 2, peroxisomal OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFL121W PE=3 SV=2 541 1087 2.0E-92
sp|Q6BJJ8|LONP2_DEBHA Lon protease homolog 2, peroxisomal OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G01892g PE=3 SV=2 623 1120 6.0E-90
sp|O69300|LON_CAMJE Lon protease OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lon PE=2 SV=2 459 904 7.0E-89
sp|A3LUF7|LONP2_PICST Lon protease homolog 2, peroxisomal OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_45980 PE=3 SV=2 623 1080 5.0E-87
sp|Q6KI22|LON_MYCMO Lon protease OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lon PE=3 SV=1 474 831 9.0E-87
sp|P78025|LON_MYCPN Lon protease OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lon PE=3 SV=1 479 838 1.0E-85
sp|Q9XW87|LONP2_CAEEL Lon protease homolog 2, peroxisomal OS=Caenorhabditis elegans GN=Y75B8A.4 PE=3 SV=1 523 845 4.0E-84
sp|A8Y3E2|LONP2_CAEBR Lon protease homolog 2, peroxisomal OS=Caenorhabditis briggsae GN=CBG23035 PE=3 SV=2 434 843 5.0E-83
sp|Q5BH58|LONP2_EMENI Lon protease homolog 2, peroxisomal OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0122 PE=3 SV=1 392 832 2.0E-81
sp|Q4A696|LON_MYCS5 Lon protease OS=Mycoplasma synoviae (strain 53) GN=lon PE=3 SV=1 479 835 2.0E-74
sp|B9WEC4|LONP2_CANDC Lon protease homolog 2, peroxisomal OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_85340 PE=3 SV=1 623 1094 1.0E-73
sp|A4S6Y4|LONM_OSTLU Lon protease homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_41620 PE=3 SV=1 909 1101 2.0E-57
sp|Q59YV0|LONP2_CANAL Lon protease homolog 2, peroxisomal OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.6973 PE=3 SV=1 623 840 3.0E-56
sp|Q5UPT0|LONH_MIMIV Lon protease homolog OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L251 PE=3 SV=1 527 1078 6.0E-54
sp|O83536|LON_TREPA Lon protease OS=Treponema pallidum (strain Nichols) GN=lon PE=3 SV=1 877 1113 9.0E-47
sp|Q72UP9|LON_LEPIC Lon protease OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lon PE=3 SV=1 899 1105 2.0E-45
sp|Q6AS16|LON1_DESPS Lon protease 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lon1 PE=3 SV=1 867 1105 1.0E-41
sp|Q6ML73|LON1_BDEBA Lon protease 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lon1 PE=3 SV=1 903 1105 3.0E-38
sp|Q6KI22|LON_MYCMO Lon protease OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lon PE=3 SV=1 906 1108 2.0E-37
sp|B8F9K1|LON_DESAA Lon protease OS=Desulfatibacillum alkenivorans (strain AK-01) GN=lon PE=3 SV=1 898 1102 1.0E-36
sp|Q6MTF4|LON_MYCMS Lon protease OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lon PE=3 SV=1 907 1105 1.0E-36
sp|P74956|LON_VIBPA Lon protease OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lon PE=3 SV=2 893 1105 7.0E-36
sp|Q9ZD92|LON_RICPR Lon protease OS=Rickettsia prowazekii (strain Madrid E) GN=lon PE=3 SV=1 896 1101 2.0E-35
sp|B2V6N0|LON_SULSY Lon protease OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=lon PE=3 SV=1 904 1115 4.0E-35
sp|Q68WS8|LON_RICTY Lon protease OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lon PE=3 SV=1 882 1101 6.0E-35
sp|B4RI01|LON_PHEZH Lon protease OS=Phenylobacterium zucineum (strain HLK1) GN=lon PE=3 SV=1 897 1109 1.0E-34
sp|Q4A696|LON_MYCS5 Lon protease OS=Mycoplasma synoviae (strain 53) GN=lon PE=3 SV=1 892 1105 1.0E-33
sp|O69300|LON_CAMJE Lon protease OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lon PE=2 SV=2 880 1102 1.0E-32
sp|A9ETZ9|LON1_SORC5 Lon protease 1 OS=Sorangium cellulosum (strain So ce56) GN=lon1 PE=3 SV=1 903 1094 3.0E-32
sp|P36773|LON1_MYXXA Lon protease 1 OS=Myxococcus xanthus GN=lon1 PE=2 SV=1 907 1101 1.0E-31
sp|B0S2N4|LON_FINM2 Lon protease OS=Finegoldia magna (strain ATCC 29328) GN=lon PE=3 SV=1 904 1105 2.0E-30
sp|P78025|LON_MYCPN Lon protease OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lon PE=3 SV=1 925 1105 1.0E-29
sp|A8Y3E2|LONP2_CAEBR Lon protease homolog 2, peroxisomal OS=Caenorhabditis briggsae GN=CBG23035 PE=3 SV=2 923 1111 4.0E-24
sp|Q9XW87|LONP2_CAEEL Lon protease homolog 2, peroxisomal OS=Caenorhabditis elegans GN=Y75B8A.4 PE=3 SV=1 923 1090 6.0E-24
sp|Q5BH58|LONP2_EMENI Lon protease homolog 2, peroxisomal OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0122 PE=3 SV=1 903 1106 8.0E-23
sp|Q59YV0|LONP2_CANAL Lon protease homolog 2, peroxisomal OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.6973 PE=3 SV=1 957 1128 1.0E-19
sp|Q7SA85|LONP2_NEUCR Lon protease homolog 2, peroxisomal OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08303 PE=3 SV=1 433 619 2.0E-15
sp|P42425|LON2_BACSU Lon protease 2 OS=Bacillus subtilis (strain 168) GN=lon2 PE=2 SV=2 998 1112 1.0E-13
sp|P93655|LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana GN=LON1 PE=1 SV=2 169 286 2.0E-13
sp|P36776|LONM_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens GN=LONP1 PE=1 SV=2 158 274 1.0E-12
sp|Q9M9L7|LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=LON4 PE=3 SV=1 175 286 2.0E-12
sp|Q58812|LONB_METJA Archaeal Lon protease OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1417 PE=1 SV=1 925 1105 2.0E-12
sp|A2YQ56|LONM_ORYSI Lon protease homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_27415 PE=2 SV=1 166 286 5.0E-12
sp|Q69UZ3|LONM_ORYSJ Lon protease homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0689300 PE=2 SV=1 166 286 5.0E-12
sp|P93648|LONM_MAIZE Lon protease homolog, mitochondrial OS=Zea mays GN=LON2 PE=1 SV=1 175 286 8.0E-12
sp|O29883|LONB_ARCFU Archaeal Lon protease OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0364 PE=1 SV=1 961 1079 2.0E-11
sp|Q59HJ6|LONM_BOVIN Lon protease homolog, mitochondrial OS=Bos taurus GN=LONP1 PE=1 SV=1 158 274 3.0E-11
sp|Q6BKJ4|LONM_DEBHA Lon protease homolog, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PIM1 PE=3 SV=2 89 293 3.0E-11
sp|Q9HSC3|LONB_HALSA Archaeal Lon protease OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_0303G PE=3 SV=1 961 1105 8.0E-10
sp|Q9M9L8|LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana GN=LON3 PE=3 SV=1 175 286 2.0E-09
sp|A3M072|LONM_PICST Lon protease homolog, mitochondrial (Fragment) OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PIM1 PE=3 SV=3 172 327 3.0E-09
sp|O26878|LONB_METTH Archaeal Lon protease OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_785 PE=3 SV=1 948 1079 3.0E-09
sp|O58221|LONB_PYRHO Archaeal Lon protease OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0452 PE=3 SV=2 934 1077 1.0E-08
sp|A4S6Y4|LONM_OSTLU Lon protease homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_41620 PE=3 SV=1 169 245 8.0E-08
sp|Q5A6N1|LONM_CANAL Lon protease homolog, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIM1 PE=3 SV=1 158 275 1.0E-07
sp|Q00WL5|LONM_OSTTA Lon protease homolog, mitochondrial OS=Ostreococcus tauri GN=Ot13g03040 PE=3 SV=2 169 221 2.0E-07
sp|B9WLN5|LONM_CANDC Lon protease homolog, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PIM1 PE=3 SV=1 158 275 2.0E-07
sp|Q9HJ89|LONB_THEAC Archaeal Lon protease OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1081 PE=1 SV=1 961 1079 2.0E-07
sp|Q8NKS6|LONB_THEKO Archaeal Lon protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=lon PE=1 SV=1 929 1105 2.0E-07
sp|Q9UYC6|LONB_PYRAB Archaeal Lon protease OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=lon PE=3 SV=1 929 1077 2.0E-07
sp|B7FSL4|LONM_PHATC Lon protease homolog, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_18202 PE=3 SV=1 172 291 3.0E-07
sp|P58274|LONB_THEVO Archaeal Lon protease OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV0493 PE=3 SV=1 961 1079 6.0E-07
sp|A3LUF7|LONP2_PICST Lon protease homolog 2, peroxisomal OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_45980 PE=3 SV=2 558 617 7.0E-07
sp|Q6BJJ8|LONP2_DEBHA Lon protease homolog 2, peroxisomal OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G01892g PE=3 SV=2 558 617 9.0E-07
sp|B9WEC4|LONP2_CANDC Lon protease homolog 2, peroxisomal OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_85340 PE=3 SV=1 558 617 2.0E-06
sp|Q59YV0|LONP2_CANAL Lon protease homolog 2, peroxisomal OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.6973 PE=3 SV=1 558 617 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004176 ATP-dependent peptidase activity Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0005524 ATP binding Yes
GO:0006508 proteolysis Yes
GO:0097159 organic cyclic compound binding No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0008236 serine-type peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0008152 metabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0005488 binding No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0016462 pyrophosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0140657 ATP-dependent activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4815
MIPSSRLPRCLFLGRARISSRNLGIGVAPRLRASAWPQSSSLQAPTLSLVPCLTSTGFSTTAVLAKENPKGKGAN
FFDSAVDSSARPPSDEEAKDKKDVQEKNEADPKPASSEPAASAKTESGNAGRDSKAAGSSAGANPGSADSGSSGD
GGKRGRKPSEKSLQKPTVPEEYPQVLAVPMARRPLFPGFYKAITIKNPEVAAAISDSIKRGQQYVGAFMFKDENR
DGDVIHDVNEVHDVGVFAQITSAFPINGNELGLTAILYPHRRIRISSLLTAPEDPDAKKTDAKGADSKGTDAQAD
VQELQDADVKDTDAKTEVEVPRPIPSKPAEMDSQLDKKGDVVASFEEGAVERKSETVREKYDPTAFLRKYKVSVV
SVENVPEEPVDPKSPNIRALATEIINVFKEVALINTLFRDQITTFSISQFNGNVVSEPGKLADFAAAVSAGEPAD
LQEILGSMDVEDRMHKALIVLKNELMNARLQNKINKEVENRITKKQREYWLVEQLKGIRRELGIDTDGREKLIEK
FKERADKLAMPEEVRKVFDEEVNKLAHLEMAASEFNVTRNYLDWLTQVPWGQRSAENFGIAHAIKVLDEDHYGLK
DVKDRILEFIAVGKLRGTVEGKILCFVGPPGVGKTSIGKSIARALNRQYYRFSVGGLTDVSEIKGHRRTYVGALP
GRIIQALKKCQTENPLILIDEVDKIGRGYQGDPSSALLELLDPEQNSSFLDHYMDVPVDLSKVLFVCTANMTDTI
PQPLLDRMELITLSGYVADEKKAIADKYLGPAAKELAGLKDADVQLTEEAITELIKSYCRESGVRNLKKQIEKVY
RKSALKIVQELGEEVLPEEEALTEEGKAAQQESEKKHEAETADGEEAKTTVSGTETTEKPRKSLKVPDSVHVEIG
KGNLNDYVGPPKFTSDRLYDVSPSGVSMGLAWTQMGGAAMYIESILQAPLRPSTRPSLEITGNLQSVMKESTTIA
YSVAKAFMARTFPDNHFFDKAKVHLHVPDGAVPKDGPSAGITMATSLLSLAMDAPVDPTAAMTGELTLTGKVLRI
GGLREKTVAARRAGCKTMIFPADNMADWLELPQNIKEGIDGHAVAWYGEVFDLVFPSLDREQANKCKICEWKSQQ
PNKGAAAAHEQSPKNE*
Coding >Ophun1|4815
ATGATTCCGTCATCTCGCCTTCCCAGATGCTTGTTTCTGGGTCGCGCCAGGATATCCAGTCGAAATCTCGGCATT
GGCGTTGCGCCTCGACTCAGGGCGTCGGCGTGGCCGCAGTCTTCGTCTCTGCAGGCCCCTACTCTCTCACTAGTA
CCTTGTCTGACCTCGACCGGCTTCTCGACGACTGCTGTCCTCGCTAAAGAGAACCCCAAGGGCAAGGGCGCAAAC
TTCTTCGACTCTGCCGTCGATTCCTCCGCTCGCCCGCCCTCGGATGAAGAGGCCAAGGACAAAAAAGATGTCCAG
GAAAAGAACGAGGCCGATCCCAAGCCGGCCAGCTCCGAACCCGCAGCGTCGGCAAAGACCGAGTCGGGCAATGCT
GGACGAGACAGCAAGGCGGCAGGCAGTTCGGCTGGCGCGAACCCCGGATCGGCGGATAGCGGATCCAGCGGCGAC
GGAGGGAAACGGGGTCGCAAGCCTTCTGAGAAATCACTGCAGAAGCCCACTGTCCCGGAAGAGTATCCGCAAGTG
CTCGCGGTACCGATGGCTAGGAGACCGCTGTTCCCCGGGTTCTACAAGGCCATCACCATTAAGAATCCAGAGGTC
GCAGCCGCCATCAGCGACTCCATCAAGCGCGGCCAGCAATACGTTGGCGCCTTCATGTTCAAGGACGAAAACAGG
GACGGAGACGTCATTCACGATGTCAATGAAGTTCACGATGTCGGCGTCTTCGCGCAAATCACCAGCGCGTTTCCC
ATCAACGGCAACGAGCTTGGCCTGACAGCCATCCTCTATCCCCATCGCCGAATTCGAATCTCTAGCCTCCTCACA
GCACCTGAAGATCCAGACGCAAAGAAAACAGACGCCAAGGGAGCAGACAGCAAGGGCACAGATGCCCAGGCAGAT
GTCCAGGAACTCCAAGACGCAGACGTCAAGGATACGGATGCCAAGACCGAGGTCGAGGTACCGCGGCCGATACCG
TCCAAGCCGGCTGAAATGGACTCACAGCTGGACAAGAAAGGAGACGTCGTCGCCAGCTTCGAAGAAGGGGCCGTC
GAGCGCAAGTCAGAGACGGTCAGAGAAAAATACGATCCCACGGCGTTCCTCAGGAAGTACAAAGTCAGCGTCGTC
AGTGTCGAGAATGTGCCTGAGGAACCTGTCGATCCCAAGAGCCCCAACATCCGGGCCCTTGCCACCGAAATCATC
AATGTCTTCAAGGAAGTCGCCTTGATCAATACACTCTTCCGAGATCAGATTACCACCTTTTCCATCAGTCAGTTC
AATGGCAACGTCGTCTCCGAGCCGGGGAAACTGGCCGATTTCGCTGCAGCCGTTTCGGCCGGAGAGCCAGCCGAC
CTGCAGGAGATTCTGGGGTCCATGGACGTCGAGGACAGGATGCACAAGGCCCTGATTGTACTCAAGAACGAACTG
ATGAATGCCAGGCTGCAGAACAAGATCAACAAGGAAGTGGAGAATCGCATCACCAAGAAGCAGCGCGAATACTGG
CTCGTTGAGCAGCTCAAGGGCATCCGTCGCGAGCTCGGCATCGACACCGACGGCAGGGAGAAGCTCATCGAGAAG
TTCAAGGAAAGGGCCGACAAGCTGGCCATGCCCGAGGAGGTCCGCAAGGTCTTTGATGAGGAGGTTAACAAGCTC
GCTCATCTGGAGATGGCGGCGTCCGAGTTCAACGTGACGCGAAACTACCTCGACTGGCTGACTCAAGTGCCATGG
GGGCAGAGGAGCGCAGAGAACTTTGGTATAGCCCACGCGATCAAGGTGCTGGACGAGGATCACTACGGGCTCAAG
GACGTCAAGGACCGCATCCTCGAGTTCATCGCCGTCGGCAAGTTGCGAGGCACCGTCGAGGGCAAGATCCTCTGC
TTCGTCGGGCCCCCGGGAGTGGGAAAGACGAGCATCGGCAAGTCCATAGCCAGGGCCCTGAACCGACAATACTAC
CGGTTCAGCGTTGGGGGGCTCACCGACGTTTCGGAAATCAAGGGCCACCGCAGGACCTATGTGGGCGCGCTGCCT
GGACGCATCATCCAGGCGCTCAAGAAGTGTCAGACGGAGAATCCGCTCATCCTCATCGACGAGGTGGACAAGATC
GGCCGGGGCTATCAGGGCGACCCGTCCTCGGCGTTGCTGGAGCTGCTCGACCCCGAGCAGAACAGCTCGTTCCTG
GATCACTACATGGATGTCCCCGTCGATCTCTCCAAGGTTCTGTTCGTGTGCACGGCCAATATGACGGATACGATC
CCCCAGCCGCTCCTGGACCGCATGGAGCTAATCACGCTCTCGGGCTACGTGGCGGACGAGAAAAAGGCCATTGCC
GACAAGTATCTGGGCCCTGCAGCCAAAGAATTGGCCGGCCTCAAGGACGCGGACGTGCAGCTGACGGAGGAGGCC
ATCACGGAGCTAATCAAGTCGTACTGCCGCGAATCGGGCGTGCGCAACCTCAAGAAGCAGATCGAAAAGGTGTAC
CGGAAATCCGCGCTCAAGATTGTGCAGGAGCTCGGAGAAGAGGTGCTCCCGGAGGAGGAGGCCCTGACAGAAGAG
GGCAAGGCGGCTCAGCAAGAGTCGGAGAAGAAGCACGAGGCGGAGACGGCAGATGGAGAGGAGGCGAAGACGACG
GTCAGCGGCACGGAGACGACGGAGAAGCCACGGAAATCTCTCAAGGTGCCAGACTCGGTACACGTCGAGATTGGC
AAGGGGAACCTAAACGACTACGTCGGGCCGCCAAAGTTCACATCAGACCGGCTCTACGACGTCAGCCCATCGGGC
GTATCGATGGGCCTGGCGTGGACGCAGATGGGGGGCGCAGCCATGTACATCGAATCCATCCTCCAGGCGCCCCTG
CGGCCAAGCACTAGGCCGAGTCTGGAGATTACGGGCAACCTCCAGTCGGTGATGAAGGAGTCGACGACGATTGCC
TATTCGGTGGCCAAGGCTTTCATGGCCAGGACGTTTCCGGACAACCACTTCTTCGACAAGGCCAAGGTGCACCTT
CACGTGCCGGACGGAGCGGTGCCCAAGGACGGGCCGTCAGCCGGCATCACCATGGCGACGTCTCTCCTCTCGCTG
GCCATGGACGCTCCCGTGGATCCGACGGCGGCCATGACGGGCGAGCTGACGCTGACGGGCAAGGTGCTGCGCATC
GGCGGCCTACGGGAGAAGACGGTGGCGGCCAGACGAGCCGGTTGCAAGACGATGATCTTTCCGGCCGACAACATG
GCCGACTGGCTGGAGCTGCCGCAGAACATCAAAGAGGGCATCGACGGTCACGCGGTGGCATGGTATGGCGAGGTG
TTTGACCTCGTGTTCCCCAGCTTGGATCGCGAACAGGCCAACAAGTGTAAGATTTGCGAGTGGAAGAGCCAACAA
CCCAACAAGGGGGCTGCGGCGGCACACGAGCAGTCGCCAAAGAACGAATAG
Transcript >Ophun1|4815
ATGATTCCGTCATCTCGCCTTCCCAGATGCTTGTTTCTGGGTCGCGCCAGGATATCCAGTCGAAATCTCGGCATT
GGCGTTGCGCCTCGACTCAGGGCGTCGGCGTGGCCGCAGTCTTCGTCTCTGCAGGCCCCTACTCTCTCACTAGTA
CCTTGTCTGACCTCGACCGGCTTCTCGACGACTGCTGTCCTCGCTAAAGAGAACCCCAAGGGCAAGGGCGCAAAC
TTCTTCGACTCTGCCGTCGATTCCTCCGCTCGCCCGCCCTCGGATGAAGAGGCCAAGGACAAAAAAGATGTCCAG
GAAAAGAACGAGGCCGATCCCAAGCCGGCCAGCTCCGAACCCGCAGCGTCGGCAAAGACCGAGTCGGGCAATGCT
GGACGAGACAGCAAGGCGGCAGGCAGTTCGGCTGGCGCGAACCCCGGATCGGCGGATAGCGGATCCAGCGGCGAC
GGAGGGAAACGGGGTCGCAAGCCTTCTGAGAAATCACTGCAGAAGCCCACTGTCCCGGAAGAGTATCCGCAAGTG
CTCGCGGTACCGATGGCTAGGAGACCGCTGTTCCCCGGGTTCTACAAGGCCATCACCATTAAGAATCCAGAGGTC
GCAGCCGCCATCAGCGACTCCATCAAGCGCGGCCAGCAATACGTTGGCGCCTTCATGTTCAAGGACGAAAACAGG
GACGGAGACGTCATTCACGATGTCAATGAAGTTCACGATGTCGGCGTCTTCGCGCAAATCACCAGCGCGTTTCCC
ATCAACGGCAACGAGCTTGGCCTGACAGCCATCCTCTATCCCCATCGCCGAATTCGAATCTCTAGCCTCCTCACA
GCACCTGAAGATCCAGACGCAAAGAAAACAGACGCCAAGGGAGCAGACAGCAAGGGCACAGATGCCCAGGCAGAT
GTCCAGGAACTCCAAGACGCAGACGTCAAGGATACGGATGCCAAGACCGAGGTCGAGGTACCGCGGCCGATACCG
TCCAAGCCGGCTGAAATGGACTCACAGCTGGACAAGAAAGGAGACGTCGTCGCCAGCTTCGAAGAAGGGGCCGTC
GAGCGCAAGTCAGAGACGGTCAGAGAAAAATACGATCCCACGGCGTTCCTCAGGAAGTACAAAGTCAGCGTCGTC
AGTGTCGAGAATGTGCCTGAGGAACCTGTCGATCCCAAGAGCCCCAACATCCGGGCCCTTGCCACCGAAATCATC
AATGTCTTCAAGGAAGTCGCCTTGATCAATACACTCTTCCGAGATCAGATTACCACCTTTTCCATCAGTCAGTTC
AATGGCAACGTCGTCTCCGAGCCGGGGAAACTGGCCGATTTCGCTGCAGCCGTTTCGGCCGGAGAGCCAGCCGAC
CTGCAGGAGATTCTGGGGTCCATGGACGTCGAGGACAGGATGCACAAGGCCCTGATTGTACTCAAGAACGAACTG
ATGAATGCCAGGCTGCAGAACAAGATCAACAAGGAAGTGGAGAATCGCATCACCAAGAAGCAGCGCGAATACTGG
CTCGTTGAGCAGCTCAAGGGCATCCGTCGCGAGCTCGGCATCGACACCGACGGCAGGGAGAAGCTCATCGAGAAG
TTCAAGGAAAGGGCCGACAAGCTGGCCATGCCCGAGGAGGTCCGCAAGGTCTTTGATGAGGAGGTTAACAAGCTC
GCTCATCTGGAGATGGCGGCGTCCGAGTTCAACGTGACGCGAAACTACCTCGACTGGCTGACTCAAGTGCCATGG
GGGCAGAGGAGCGCAGAGAACTTTGGTATAGCCCACGCGATCAAGGTGCTGGACGAGGATCACTACGGGCTCAAG
GACGTCAAGGACCGCATCCTCGAGTTCATCGCCGTCGGCAAGTTGCGAGGCACCGTCGAGGGCAAGATCCTCTGC
TTCGTCGGGCCCCCGGGAGTGGGAAAGACGAGCATCGGCAAGTCCATAGCCAGGGCCCTGAACCGACAATACTAC
CGGTTCAGCGTTGGGGGGCTCACCGACGTTTCGGAAATCAAGGGCCACCGCAGGACCTATGTGGGCGCGCTGCCT
GGACGCATCATCCAGGCGCTCAAGAAGTGTCAGACGGAGAATCCGCTCATCCTCATCGACGAGGTGGACAAGATC
GGCCGGGGCTATCAGGGCGACCCGTCCTCGGCGTTGCTGGAGCTGCTCGACCCCGAGCAGAACAGCTCGTTCCTG
GATCACTACATGGATGTCCCCGTCGATCTCTCCAAGGTTCTGTTCGTGTGCACGGCCAATATGACGGATACGATC
CCCCAGCCGCTCCTGGACCGCATGGAGCTAATCACGCTCTCGGGCTACGTGGCGGACGAGAAAAAGGCCATTGCC
GACAAGTATCTGGGCCCTGCAGCCAAAGAATTGGCCGGCCTCAAGGACGCGGACGTGCAGCTGACGGAGGAGGCC
ATCACGGAGCTAATCAAGTCGTACTGCCGCGAATCGGGCGTGCGCAACCTCAAGAAGCAGATCGAAAAGGTGTAC
CGGAAATCCGCGCTCAAGATTGTGCAGGAGCTCGGAGAAGAGGTGCTCCCGGAGGAGGAGGCCCTGACAGAAGAG
GGCAAGGCGGCTCAGCAAGAGTCGGAGAAGAAGCACGAGGCGGAGACGGCAGATGGAGAGGAGGCGAAGACGACG
GTCAGCGGCACGGAGACGACGGAGAAGCCACGGAAATCTCTCAAGGTGCCAGACTCGGTACACGTCGAGATTGGC
AAGGGGAACCTAAACGACTACGTCGGGCCGCCAAAGTTCACATCAGACCGGCTCTACGACGTCAGCCCATCGGGC
GTATCGATGGGCCTGGCGTGGACGCAGATGGGGGGCGCAGCCATGTACATCGAATCCATCCTCCAGGCGCCCCTG
CGGCCAAGCACTAGGCCGAGTCTGGAGATTACGGGCAACCTCCAGTCGGTGATGAAGGAGTCGACGACGATTGCC
TATTCGGTGGCCAAGGCTTTCATGGCCAGGACGTTTCCGGACAACCACTTCTTCGACAAGGCCAAGGTGCACCTT
CACGTGCCGGACGGAGCGGTGCCCAAGGACGGGCCGTCAGCCGGCATCACCATGGCGACGTCTCTCCTCTCGCTG
GCCATGGACGCTCCCGTGGATCCGACGGCGGCCATGACGGGCGAGCTGACGCTGACGGGCAAGGTGCTGCGCATC
GGCGGCCTACGGGAGAAGACGGTGGCGGCCAGACGAGCCGGTTGCAAGACGATGATCTTTCCGGCCGACAACATG
GCCGACTGGCTGGAGCTGCCGCAGAACATCAAAGAGGGCATCGACGGTCACGCGGTGGCATGGTATGGCGAGGTG
TTTGACCTCGTGTTCCCCAGCTTGGATCGCGAACAGGCCAACAAGTGTAAGATTTGCGAGTGGAAGAGCCAACAA
CCCAACAAGGGGGCTGCGGCGGCACACGAGCAGTCGCCAAAGAACGAATAG
Gene >Ophun1|4815
ATGATTCCGTCATCTCGCCTTCCCAGATGCTTGTTTCTGGGTCGCGCCAGGATATCCAGTCGAAATCTCGGCATT
GGCGTTGCGCCTCGACTCAGGGCGTCGGCGTGGCCGCAGTCTTCGTCTCTGCAGGCCCCTACTCTCTCACTAGTA
CCTTGTCTGACCTCGACCGGCTTCTCGACGACTGCTGTCCTCGCTAAAGAGAACCCCAAGGGCAAGGGCGCAAAC
TTCTTCGACTCTGCCGTCGATTCCTCCGCTCGCCCGCCCTCGGATGAAGAGGCCAAGGACAAAAAAGATGTCCAG
GAAAAGAACGAGGCCGATCCCAAGCCGGCCAGCTCCGAACCCGCAGCGTCGGCAAAGACCGAGTCGGGCAATGCT
GGACGAGACAGCAAGGCGGCAGGCAGTTCGGCTGGCGCGAACCCCGGATCGGCGGATAGCGGATCCAGCGGCGAC
GGAGGGAAACGGGGTCGCAAGCCTTCTGAGAAATCACTGCAGAAGCCCACTGTCCCGGAAGAGTATCCGCAAGTG
CTCGCGGTACCGATGGCTAGGAGACCGCTGTTCCCCGGGTTCTACAAGGCCATCACCATTAAGAATCCAGAGGTC
GCAGCCGCCATCAGCGACTCCATCAAGCGCGGCCAGCAATACGTTGGCGCCTTCATGTTCAAGGACGAAAACAGG
GACGGAGACGTCATTCACGATGTCAATGAAGTTCACGATGTCGGCGTCTTCGCGCAAATCACCAGCGCGTTTCCC
ATCAACGGCAACGAGCTTGGCCTGACAGCCATCCTCTATCCCCATCGCCGAATTCGAATCTCTAGCCTCCTCACA
GCACCTGAAGATCCAGACGCAAAGAAAACAGACGCCAAGGGAGCAGACAGCAAGGGCACAGATGCCCAGGCAGAT
GTCCAGGAACTCCAAGACGCAGACGTCAAGGATACGGATGCCAAGACCGAGGTCGAGGTACCGCGGCCGATACCG
TCCAAGCCGGCTGAAATGGACTCACAGCTGGACAAGAAAGGAGACGTCGTCGCCAGCTTCGAAGAAGGGGCCGTC
GAGCGCAAGTCAGAGACGGTCAGAGAAAAATACGATCCCACGGCGTTCCTCAGGAAGTACAAAGTCAGCGTCGTC
AGTGTCGAGAATGTGCCTGAGGAACCTGTCGATCCCAAGAGCCCCAACATCCGGGCCCTTGCCACCGAAATCATC
AATGTCTTCAAGGAAGTCGCCTTGATCAATACACTCTTCCGAGATCAGATTACCACCTTTTCCATCAGTCAGTTC
AATGGCAACGTCGTCTCCGAGCCGGGGAAACTGGCCGATTTCGCTGCAGCCGTTTCGGCCGGAGAGCCAGCCGAC
CTGCAGGAGATTCTGGGGTCCATGGACGTCGAGGACAGGATGCACAAGGCCCTGATTGTACTCAAGAACGAACTG
ATGAATGCCAGGCTGCAGAACAAGATCAACAAGGAAGTGGAGAATCGCATCACCAAGAAGCAGCGCGAATACTGG
CTCGTTGAGCAGCTCAAGGGCATCCGTCGCGAGCTCGGCATCGACACCGACGGCAGGGAGAAGCTCATCGAGAAG
TTCAAGGAAAGGGCCGACAAGCTGGCCATGCCCGAGGAGGTCCGCAAGGTCTTTGATGAGGAGGTTAACAAGCTC
GCTCATCTGGAGATGGCGGCGTCCGAGTTCAACGTGACGCGAAACTACCTCGACTGGCTGACTCAAGTGCCATGG
GGGCAGAGGAGCGCAGAGAACTTTGGTATAGCCCACGCGATCAAGGTGCTGGACGAGGATCACTACGGGCTCAAG
GACGTCAAGGACCGCATCCTCGAGTTCATCGCCGTCGGCAAGTTGCGAGGCACCGTCGAGGGCAAGATCCTCTGC
TTCGTCGGGCCCCCGGGAGTGGGAAAGACGAGCATCGGCAAGTCCATAGCCAGGGCCCTGAACCGACAATACTAC
CGGTTCAGCGTTGGGGGGCTCACCGACGTTTCGGAAATCAAGGGCCACCGCAGGACCTATGTGGGCGCGCTGCCT
GGACGCATCATCCAGGCGCTCAAGAAGTGTCAGACGGAGAATCCGCTCATCCTCATCGACGAGGTGGACAAGATC
GGCCGGGGCTATCAGGGCGACCCGTCCTCGGCGTTGCTGGAGCTGCTCGACCCCGAGCAGAACAGCTCGTTCCTG
GATCACTACATGGATGTCCCCGTCGATCTCTCCAAGGTTCTGTTCGTGTGCACGGCCAATATGACGGATACGATC
CCCCAGCCGCTCCTGGACCGCATGGAGCTAATCACGCTCTCGGGCTACGTGGCGGACGAGAAAAAGGCCATTGCC
GACAAGTATCTGGGCCCTGCAGCCAAAGAATTGGCCGGCCTCAAGGACGCGGACGTGCAGCTGACGGAGGAGGCC
ATCACGGAGCTAATCAAGTCGTACTGCCGCGAATCGGGCGTGCGCAACCTCAAGAAGCAGATCGAAAAGGTGTAC
CGGAAATCCGCGCTCAAGATTGTGCAGGAGCTCGGAGAAGAGGTGCTCCCGGAGGAGGAGGCCCTGACAGAAGAG
GGCAAGGCGGCTCAGCAAGAGTCGGAGAAGAAGCACGAGGCGGAGACGGCAGATGGAGAGGAGGCGAAGACGACG
GTCAGCGGCACGGAGACGACGGAGAAGCCACGGAAATCTCTCAAGGTGCCAGACTCGGTACACGTCGAGATTGGC
AAGGGGAACCTAAACGACTACGTCGGGCCGCCAAAGTTCACATCAGACCGGCTCTACGACGTCAGCCCATCGGGC
GTATCGATGGGCCTGGCGTGGACGCAGATGGGGGGCGCAGCCATGTACATCGAATCCATCCTCCAGGCGCCCCTG
CGGCCAAGCACTAGGCCGAGTCTGGAGATTACGGGCAACCTCCAGTCGGTGATGAAGGAGTCGACGACGATTGCC
TATTCGGTGGCCAAGGCTTTCATGGCCAGGACGTTTCCGGACAACCACTTCTTCGACAAGGCCAAGGTGCACCTT
CACGTGCCGGACGGAGCGGTGCCCAAGGACGGGCCGTCAGCCGGCATCACCATGGCGACGTCTCTCCTCTCGCTG
GCCATGGACGCTCCCGTGGATCCGACGGCGGCCATGACGGGCGAGCTGACGCTGACGGGCAAGGTGCTGCGCATC
GGCGGCCTACGGGAGAAGACGGTGGCGGCCAGACGAGCCGGTTGCAAGACGATGATCTTTCCGGCCGACAACATG
GCCGACTGGCTGGAGCTGCCGCAGGTTTGTGACATTGTTGTTCCCACCACGGTTGTCTCTTGACTGACGGGTTGC
AGAACATCAAAGAGGGCATCGACGGTCACGCGGTGGCATGGTATGGCGAGGTGTTTGACCTCGTGTTCCCCAGCT
TGGATCGCGAACAGGCCAACAAGTGTAAGATTTGCGAGTGGAAGAGCCAACAACCCAACAAGGGGGCTGCGGCGG
CACACGAGCAGTCGCCAAAGAACGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail