Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4814
Gene name
LocationContig_452:11079..14308
Strand-
Gene length (bp)3229
Transcript length (bp)2961
Coding sequence length (bp)2961
Protein length (aa) 987

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03105 SPX SPX domain 4.9E-12 161 197
PF03105 SPX SPX domain 5.1E-25 198 400
PF00939 Na_sulph_symp Sodium:sulfate symporter transmembrane region 3.1E-33 524 976
PF03600 CitMHS Citrate transporter 2.9E-25 557 918

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 349 985 0.0E+00
sp|P27514|PHO91_YEAST Low-affinity phosphate transporter PHO91 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO91 PE=1 SV=2 161 985 0.0E+00
sp|P39535|PHO90_YEAST Low-affinity phosphate transporter PHO90 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO90 PE=1 SV=1 359 980 3.0E-155
sp|P25360|PHO87_YEAST Inorganic phosphate transporter PHO87 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO87 PE=1 SV=2 354 979 2.0E-150
sp|Q58086|Y672_METJA Uncharacterized transporter MJ0672 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0672 PE=3 SV=1 549 975 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 349 985 0.0E+00
sp|P27514|PHO91_YEAST Low-affinity phosphate transporter PHO91 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO91 PE=1 SV=2 161 985 0.0E+00
sp|P39535|PHO90_YEAST Low-affinity phosphate transporter PHO90 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO90 PE=1 SV=1 359 980 3.0E-155
sp|P25360|PHO87_YEAST Inorganic phosphate transporter PHO87 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO87 PE=1 SV=2 354 979 2.0E-150
sp|Q58086|Y672_METJA Uncharacterized transporter MJ0672 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0672 PE=3 SV=1 549 975 1.0E-21
sp|Q49YW0|SDCS_STAS1 Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sdcS PE=3 SV=1 548 937 4.0E-20
sp|Q8LG88|TDT_ARATH Tonoplast dicarboxylate transporter OS=Arabidopsis thaliana GN=TDT PE=2 SV=2 541 976 2.0E-19
sp|Q57486|Y608_HAEIN Uncharacterized transporter HI_0608 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0608 PE=3 SV=1 518 977 3.0E-17
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 161 248 5.0E-17
sp|Q21339|NAD3_CAEEL Sodium-dependent high-affinity dicarboxylate transporter 3 OS=Caenorhabditis elegans GN=nac-3 PE=2 SV=3 542 937 1.0E-15
sp|Q2YU56|SDCS_STAAB Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sdcS PE=3 SV=1 544 986 5.0E-15
sp|Q8NVS5|SDCS_STAAW Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain MW2) GN=sdcS PE=3 SV=1 548 986 7.0E-15
sp|Q6G816|SDCS_STAAS Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain MSSA476) GN=sdcS PE=3 SV=1 548 986 7.0E-15
sp|Q93655|NAD1_CAEEL Sodium-dependent low-affinity dicarboxylate transporter 1 OS=Caenorhabditis elegans GN=nac-1 PE=2 SV=3 534 973 7.0E-14
sp|Q9VVT2|INDY1_DROME Protein I'm not dead yet OS=Drosophila melanogaster GN=Indy PE=1 SV=2 534 725 4.0E-11
sp|Q67BT3|S13A5_MOUSE Solute carrier family 13 member 5 OS=Mus musculus GN=Slc13a5 PE=2 SV=1 520 685 4.0E-09
sp|Q07252|MEMP_CUPNH Membrane protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A0667 PE=3 SV=2 546 967 1.0E-08
sp|Q86YT5|S13A5_HUMAN Solute carrier family 13 member 5 OS=Homo sapiens GN=SLC13A5 PE=1 SV=1 543 694 3.0E-08
sp|Q8CJ44|S13A5_RAT Solute carrier family 13 member 5 OS=Rattus norvegicus GN=Slc13a5 PE=2 SV=1 548 685 6.0E-08
sp|Q8WWT9|S13A3_HUMAN Solute carrier family 13 member 3 OS=Homo sapiens GN=SLC13A3 PE=1 SV=1 533 693 3.0E-07
sp|Q9UKG4|S13A4_HUMAN Solute carrier family 13 member 4 OS=Homo sapiens GN=SLC13A4 PE=2 SV=2 543 690 7.0E-07
sp|Q91Y63|S13A3_MOUSE Solute carrier family 13 member 3 OS=Mus musculus GN=Slc13a3 PE=1 SV=1 544 698 8.0E-07
sp|P32739|NAD2_CAEEL Sodium-dependent high-affinity dicarboxylate transporter 2 OS=Caenorhabditis elegans GN=nac-2 PE=2 SV=3 534 757 9.0E-07
sp|Q9Z0Z5|S13A3_RAT Solute carrier family 13 member 3 OS=Rattus norvegicus GN=Slc13a3 PE=2 SV=1 544 693 1.0E-06
sp|Q28615|S13A2_RABIT Solute carrier family 13 member 2 OS=Oryctolagus cuniculus GN=SLC13A2 PE=2 SV=1 544 685 1.0E-06
sp|Q9JHI4|S13A1_MOUSE Solute carrier family 13 member 1 OS=Mus musculus GN=Slc13a1 PE=2 SV=2 524 679 2.0E-06
sp|Q9ES88|S13A2_MOUSE Solute carrier family 13 member 2 OS=Mus musculus GN=Slc13a2 PE=2 SV=1 542 679 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 514 536 22
2 549 571 22
3 604 626 22
4 650 672 22
5 694 713 19
6 734 756 22
7 776 793 17
8 800 822 22
9 832 854 22
10 867 889 22
11 915 937 22
12 957 979 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4814
MTGMDMMHRAVGAKPACMPAYEANIRSLLVVKKGHATKIPSAAASDAPSSADGNRRPTGDRGGGGRREGDDRDDD
DDDDDDIQDEDQDQDQDYEFHNCDIKLHRQEAHRIQAQQNSTQEHNKSASLVQSYELADYPRSDAHHRRRRKRLR
KRRWLEKQDEMKFSHSIQFNAVPDWSSHYIAYSNLKKLIYQLERTVHQSRSNDVESRPLVAADNPDDVFSAALNV
ELDKICSFYVVKQKEILDEAAQLLRDIRDRSHPLDGTAPLRRVVSDGHDGRGITFDDEDGEDSASDDDENTGLNK
TRHTRRKRLSSVGHRQDLASSAEFGRSLRLSNVIDYYEEPSLMLLQDLHSSAIMLKKRIISLYVQLCELKSYIQL
NRTGFAKVLKKFDKILFRELKGPYLGSHVDTAYPFRPDTRKLVDDNIAEMEAAYADVVTGGDTGLANKELRSHLR
EHVVWERNTVWRDLIGIERRAEAARLGQSLLGQDQAVALQGDAADGLPAIKHLQTPLGRLSLPVWLANGSIPTLV
ISIAVFFALLFVPILQKAEQQNCLAMLVFVSILWATETIPLFVTSLLVPFLSVVLRVVREEDPVKPPVRLDSREA
THAIFASMWTPVIMLLLGGFTLAAALSKCTIDKRLATLILSKAGTRPRTVLVANMFVAAFASMLISNVAAPVLCY
SIIEPMLRTLPSDSDMSKAIIIGIALASNIGGMLSPIASPQNVVAMGIMDPEPTWLQWFFIVIPVGAVSLLLIWL
LLLVTFQPGKGTVIVPIRPLKEPFTGVQWFVSLVAIATVALWCASHQMEGVFGDMGVIAIMPIVLFFGIGILTKE
DFNNFPWTIIILAAGGLSLGKAVRSSGLLHVFAEVVSDNVEGMSLYGILFVFSTLILVIATFISHTVAALIFLPL
VYDVGAAMDQPQPNLLVMGGVLMCSAAMGLPTSGFPNMTAIMKEDAAGQRYLRVKHFITRGVPSSVITLVVVMTL
GFGIMEVAGLD*
Coding >Ophun1|4814
ATGACGGGCATGGATATGATGCATCGGGCCGTTGGCGCCAAGCCGGCGTGCATGCCTGCTTACGAGGCTAACATT
AGGAGCCTCTTGGTAGTGAAAAAGGGTCACGCCACCAAGATTCCGTCCGCGGCTGCTTCCGACGCTCCCTCCTCC
GCTGACGGCAACCGACGACCGACGGGCGACCGAGGAGGAGGAGGGAGACGCGAAGGTGACGATAGAGACGACGAC
GACGACGACGACGACGACATACAAGACGAAGACCAAGACCAAGACCAAGACTACGAGTTTCATAACTGTGACATT
AAGCTCCACCGCCAGGAGGCCCACCGCATTCAGGCCCAACAAAACTCTACCCAAGAGCATAATAAGAGCGCCTCT
CTCGTCCAGTCATACGAACTCGCCGATTATCCCCGATCCGACGCACATCACAGAAGGCGCCGGAAGCGATTGCGG
AAGCGCCGCTGGCTCGAGAAGCAGGACGAGATGAAGTTTTCCCACAGCATTCAGTTCAATGCTGTTCCCGACTGG
AGCAGCCATTACATTGCCTACAGCAATCTCAAGAAGCTCATCTATCAGCTCGAGAGGACGGTTCATCAGAGCCGG
TCTAATGACGTCGAGTCTAGGCCCCTTGTTGCCGCGGACAATCCCGATGATGTCTTTTCCGCTGCCCTCAACGTC
GAGCTCGACAAGATCTGCTCCTTTTACGTCGTGAAGCAGAAAGAGATCCTCGATGAGGCCGCTCAGCTCCTCCGC
GACATCCGCGACCGCTCCCATCCGCTTGACGGCACCGCGCCTCTGCGAAGAGTCGTCTCCGATGGTCACGATGGT
CGGGGCATCACGTTCGATGACGAAGACGGCGAGGACAGCGCCAGCGACGACGATGAGAATACCGGCCTGAATAAG
ACTCGACATACTCGCAGAAAGAGGCTCTCCTCCGTCGGCCATCGCCAGGATCTGGCCTCGTCTGCCGAGTTTGGT
CGTTCGCTCCGGCTCAGCAACGTCATCGACTATTACGAAGAGCCGTCTCTCATGCTGCTGCAGGACCTTCACTCT
TCCGCCATCATGCTCAAGAAGCGCATCATCAGCCTCTACGTCCAACTGTGCGAACTTAAGTCGTACATCCAGCTC
AACAGAACCGGCTTCGCAAAGGTCCTCAAAAAGTTCGACAAGATCCTCTTCAGGGAGCTCAAGGGCCCGTATCTC
GGCTCTCACGTCGACACGGCCTACCCCTTCAGACCGGACACGAGGAAGCTGGTCGACGACAACATCGCTGAAATG
GAGGCTGCTTACGCCGATGTCGTCACAGGCGGCGACACGGGGTTGGCAAACAAGGAGTTGCGCTCTCACCTGCGA
GAGCATGTCGTCTGGGAGCGGAACACGGTCTGGAGGGACTTGATTGGTATTGAGCGTCGCGCTGAGGCTGCTCGG
CTTGGACAATCGCTTCTTGGTCAGGATCAGGCTGTGGCGTTGCAGGGCGATGCTGCTGATGGTCTGCCTGCAATC
AAGCACCTGCAGACACCCCTGGGACGCCTTTCACTGCCGGTCTGGCTGGCCAACGGGTCGATTCCGACGCTCGTC
ATCTCCATCGCCGTCTTCTTTGCTCTCCTCTTCGTTCCCATCCTGCAAAAGGCCGAGCAGCAGAACTGTCTGGCC
ATGCTCGTCTTCGTCAGCATCCTCTGGGCCACCGAGACAATACCGCTCTTCGTCACCTCCCTGCTGGTGCCCTTC
CTCTCCGTGGTTCTGAGGGTGGTCCGCGAGGAGGACCCGGTCAAGCCCCCCGTCCGTCTCGACTCTCGAGAGGCG
ACGCATGCCATCTTCGCCTCCATGTGGACTCCCGTCATCATGCTGCTGCTCGGTGGCTTCACCCTCGCCGCCGCG
CTGTCCAAGTGCACCATCGACAAGCGGCTCGCCACGCTCATCCTCAGCAAGGCCGGCACTCGGCCGCGGACGGTG
CTGGTGGCCAACATGTTTGTCGCCGCCTTTGCTTCCATGCTCATCAGCAATGTGGCCGCTCCTGTTCTCTGCTAC
TCCATCATCGAGCCGATGCTGCGGACGCTGCCATCCGACTCGGACATGTCAAAGGCCATCATCATCGGCATCGCC
CTGGCGTCCAACATTGGCGGCATGCTCTCGCCCATCGCCTCTCCGCAGAACGTGGTGGCCATGGGCATCATGGAC
CCAGAGCCGACCTGGCTGCAGTGGTTCTTCATCGTCATTCCCGTCGGCGCCGTCTCGCTGCTGCTCATCTGGCTG
CTGCTCCTCGTCACCTTTCAGCCCGGCAAGGGCACCGTCATCGTCCCGATCCGGCCGCTCAAGGAACCGTTTACG
GGCGTGCAGTGGTTCGTGTCGCTCGTTGCCATTGCCACGGTGGCCTTGTGGTGCGCCAGCCACCAGATGGAGGGC
GTCTTTGGCGACATGGGAGTCATCGCCATCATGCCCATTGTCCTGTTCTTCGGCATCGGCATCCTCACCAAGGAG
GACTTTAACAACTTTCCCTGGACCATCATCATCCTGGCTGCTGGCGGGCTGTCGCTGGGTAAAGCGGTGCGTTCG
TCGGGGTTGTTGCACGTCTTCGCCGAGGTGGTGTCGGATAATGTCGAGGGCATGAGCCTTTACGGCATTCTCTTC
GTCTTCTCGACGCTGATACTCGTCATCGCCACTTTTATCAGCCATACGGTTGCGGCCCTCATCTTTCTGCCGCTG
GTGTACGACGTGGGCGCGGCCATGGACCAGCCGCAGCCGAACCTGCTCGTCATGGGCGGTGTTCTCATGTGCAGC
GCGGCCATGGGTCTGCCTACGAGTGGCTTCCCCAACATGACTGCTATTATGAAGGAGGATGCTGCGGGGCAGAGA
TATCTGCGCGTGAAGCATTTCATTACCAGGGGTGTGCCGAGCAGTGTCATTACGCTGGTGGTTGTCATGACGCTT
GGGTTTGGGATCATGGAGGTTGCTGGCTTGGATTAG
Transcript >Ophun1|4814
ATGACGGGCATGGATATGATGCATCGGGCCGTTGGCGCCAAGCCGGCGTGCATGCCTGCTTACGAGGCTAACATT
AGGAGCCTCTTGGTAGTGAAAAAGGGTCACGCCACCAAGATTCCGTCCGCGGCTGCTTCCGACGCTCCCTCCTCC
GCTGACGGCAACCGACGACCGACGGGCGACCGAGGAGGAGGAGGGAGACGCGAAGGTGACGATAGAGACGACGAC
GACGACGACGACGACGACATACAAGACGAAGACCAAGACCAAGACCAAGACTACGAGTTTCATAACTGTGACATT
AAGCTCCACCGCCAGGAGGCCCACCGCATTCAGGCCCAACAAAACTCTACCCAAGAGCATAATAAGAGCGCCTCT
CTCGTCCAGTCATACGAACTCGCCGATTATCCCCGATCCGACGCACATCACAGAAGGCGCCGGAAGCGATTGCGG
AAGCGCCGCTGGCTCGAGAAGCAGGACGAGATGAAGTTTTCCCACAGCATTCAGTTCAATGCTGTTCCCGACTGG
AGCAGCCATTACATTGCCTACAGCAATCTCAAGAAGCTCATCTATCAGCTCGAGAGGACGGTTCATCAGAGCCGG
TCTAATGACGTCGAGTCTAGGCCCCTTGTTGCCGCGGACAATCCCGATGATGTCTTTTCCGCTGCCCTCAACGTC
GAGCTCGACAAGATCTGCTCCTTTTACGTCGTGAAGCAGAAAGAGATCCTCGATGAGGCCGCTCAGCTCCTCCGC
GACATCCGCGACCGCTCCCATCCGCTTGACGGCACCGCGCCTCTGCGAAGAGTCGTCTCCGATGGTCACGATGGT
CGGGGCATCACGTTCGATGACGAAGACGGCGAGGACAGCGCCAGCGACGACGATGAGAATACCGGCCTGAATAAG
ACTCGACATACTCGCAGAAAGAGGCTCTCCTCCGTCGGCCATCGCCAGGATCTGGCCTCGTCTGCCGAGTTTGGT
CGTTCGCTCCGGCTCAGCAACGTCATCGACTATTACGAAGAGCCGTCTCTCATGCTGCTGCAGGACCTTCACTCT
TCCGCCATCATGCTCAAGAAGCGCATCATCAGCCTCTACGTCCAACTGTGCGAACTTAAGTCGTACATCCAGCTC
AACAGAACCGGCTTCGCAAAGGTCCTCAAAAAGTTCGACAAGATCCTCTTCAGGGAGCTCAAGGGCCCGTATCTC
GGCTCTCACGTCGACACGGCCTACCCCTTCAGACCGGACACGAGGAAGCTGGTCGACGACAACATCGCTGAAATG
GAGGCTGCTTACGCCGATGTCGTCACAGGCGGCGACACGGGGTTGGCAAACAAGGAGTTGCGCTCTCACCTGCGA
GAGCATGTCGTCTGGGAGCGGAACACGGTCTGGAGGGACTTGATTGGTATTGAGCGTCGCGCTGAGGCTGCTCGG
CTTGGACAATCGCTTCTTGGTCAGGATCAGGCTGTGGCGTTGCAGGGCGATGCTGCTGATGGTCTGCCTGCAATC
AAGCACCTGCAGACACCCCTGGGACGCCTTTCACTGCCGGTCTGGCTGGCCAACGGGTCGATTCCGACGCTCGTC
ATCTCCATCGCCGTCTTCTTTGCTCTCCTCTTCGTTCCCATCCTGCAAAAGGCCGAGCAGCAGAACTGTCTGGCC
ATGCTCGTCTTCGTCAGCATCCTCTGGGCCACCGAGACAATACCGCTCTTCGTCACCTCCCTGCTGGTGCCCTTC
CTCTCCGTGGTTCTGAGGGTGGTCCGCGAGGAGGACCCGGTCAAGCCCCCCGTCCGTCTCGACTCTCGAGAGGCG
ACGCATGCCATCTTCGCCTCCATGTGGACTCCCGTCATCATGCTGCTGCTCGGTGGCTTCACCCTCGCCGCCGCG
CTGTCCAAGTGCACCATCGACAAGCGGCTCGCCACGCTCATCCTCAGCAAGGCCGGCACTCGGCCGCGGACGGTG
CTGGTGGCCAACATGTTTGTCGCCGCCTTTGCTTCCATGCTCATCAGCAATGTGGCCGCTCCTGTTCTCTGCTAC
TCCATCATCGAGCCGATGCTGCGGACGCTGCCATCCGACTCGGACATGTCAAAGGCCATCATCATCGGCATCGCC
CTGGCGTCCAACATTGGCGGCATGCTCTCGCCCATCGCCTCTCCGCAGAACGTGGTGGCCATGGGCATCATGGAC
CCAGAGCCGACCTGGCTGCAGTGGTTCTTCATCGTCATTCCCGTCGGCGCCGTCTCGCTGCTGCTCATCTGGCTG
CTGCTCCTCGTCACCTTTCAGCCCGGCAAGGGCACCGTCATCGTCCCGATCCGGCCGCTCAAGGAACCGTTTACG
GGCGTGCAGTGGTTCGTGTCGCTCGTTGCCATTGCCACGGTGGCCTTGTGGTGCGCCAGCCACCAGATGGAGGGC
GTCTTTGGCGACATGGGAGTCATCGCCATCATGCCCATTGTCCTGTTCTTCGGCATCGGCATCCTCACCAAGGAG
GACTTTAACAACTTTCCCTGGACCATCATCATCCTGGCTGCTGGCGGGCTGTCGCTGGGTAAAGCGGTGCGTTCG
TCGGGGTTGTTGCACGTCTTCGCCGAGGTGGTGTCGGATAATGTCGAGGGCATGAGCCTTTACGGCATTCTCTTC
GTCTTCTCGACGCTGATACTCGTCATCGCCACTTTTATCAGCCATACGGTTGCGGCCCTCATCTTTCTGCCGCTG
GTGTACGACGTGGGCGCGGCCATGGACCAGCCGCAGCCGAACCTGCTCGTCATGGGCGGTGTTCTCATGTGCAGC
GCGGCCATGGGTCTGCCTACGAGTGGCTTCCCCAACATGACTGCTATTATGAAGGAGGATGCTGCGGGGCAGAGA
TATCTGCGCGTGAAGCATTTCATTACCAGGGGTGTGCCGAGCAGTGTCATTACGCTGGTGGTTGTCATGACGCTT
GGGTTTGGGATCATGGAGGTTGCTGGCTTGGATTAG
Gene >Ophun1|4814
ATGACGGGCATGGATATGATGCATCGGGCCGTTGGCGCCAAGCCGGCGTGCATGCCTGCTTACGAGGCTAACATT
AGGAGCCTCTTGGTAGTGAAAAAGGGTCGTCAGTCAAGTCGTTAGGAGGTTGCACCGTCTCTGTCTGGCCAAGCA
AGCTTCAGCTGAATTGCTTTTCCCGCGCAACCCACCACGTTAAAAAAAAGAGGCCAAGACGCCACCAAGATTCCG
TCCGCGGCTGCTTCCGACGCTCCCTCCTCCGCTGACGGCAACCGACGACCGACGGGCGACCGAGGAGGAGGAGGG
AGACGCGAAGGTGACGATAGAGACGACGACGACGACGACGACGACGACATACAAGACGAAGACCAAGACCAAGAC
CAAGACTACGAGTTTCATAACTGTGACATTAAGCTCCACCGCCAGGAGGCCCACCGCATTCAGGCCCAACAAAAC
TCTACCCAAGAGCATAATAAGAGCGCCTCTCTCGTCCAGTCATACGAACTCGCCGATTATCCCCGATCCGACGCA
CATCACAGAAGGCGCCGGAAGCGATTGCGGAAGCGCCGCTGGCTCGAGAAGCAGGACGAGATGAAGTTTTCCCAC
AGCATTCAGTTCAATGCTGTTCCCGACTGGAGCAGCCATTACATTGCCTACAGCAATCTCAAGAAGCTGTTGGAC
GCCCCCGCCCCTGATTGCTACTACTACATCGCTGACCTTGGCCTCTAGCATCTATCAGCTCGAGAGGACGGTTCA
TCAGAGCCGGTCTAATGACGTCGAGTCTAGGCCCCTTGTTGCCGCGGACAATCCCGATGATGTCTTTTCCGCTGC
CCTCAACGTCGAGCTCGACAAGATCTGCTCCTTTTACGTCGTGAAGCAGAAAGAGATCCTCGATGAGGCCGCTCA
GCTCCTCCGCGACATCCGCGACCGCTCCCATCCGCTTGACGGCACCGCGCCTCTGCGAAGAGTCGTCTCCGATGG
TCACGATGGTCGGGGCATCACGTTCGATGACGAAGACGGCGAGGACAGCGCCAGCGACGACGATGAGAATACCGG
CCTGAATAAGACTCGACATACTCGCAGAAAGAGGCTCTCCTCCGTCGGCCATCGCCAGGATCTGGCCTCGTCTGC
CGAGTTTGGTCGTTCGCTCCGGCTCAGCAACGTCATCGACTATTACGAAGAGCCGTCTCTCATGCTGCTGCAGGA
CCTTCACTCTTCCGCCATCATGCTCAAGAAGCGCATCATCAGCCTCTACGTCCAACTGTGCGAACTTAAGTCGTA
CATCCAGCTCAACAGAACCGGCTTCGCAAAGGTCCTCAAAAAGTTCGACAAGATCCTCTTCAGGGAGCTCAAGGG
CCCGTATCTCGGCTCTCACGTCGACACGGCCTACCCCTTCAGACCGGACACGAGGAAGCTGGTCGACGACAACAT
CGCTGAAATGGAGGCTGCTTACGCCGATGTCGTCACAGGCGGCGACACGGGGTTGGCAAACAAGGAGTTGCGCTC
TCACCTGCGAGAGCATGTCGTCTGGGAGCGGAACACGGTCTGGAGGGACTTGATTGGTATTGAGCGTCGCGCTGA
GGCTGCTCGGCTTGGACAATCGCTTCTTGGTCAGGATCAGGCTGTGGCGTTGCAGGGCGATGCTGCTGATGGTCT
GCCTGCAATCAAGCACCTGCAGACACCCCTGGGACGCCTTTCACTGCCGGTCTGGCTGGCCAACGGGTCGATTCC
GACGCTCGTCATCTCCATCGCCGTCTTCTTTGCTCTCCTCTTCGTTCCCATCCTGCAAAAGGCCGAGCAGCAGAA
CTGTCTGGCCATGCTCGTCTTCGTCAGCATCCTCTGGGCCACCGAGGTGAGTGTCGGCCGCAGCCCCTTTTCTCC
CGTGCGTCTCTTCTGAATGGTCCTCAGACAATACCGCTCTTCGTCACCTCCCTGCTGGTGCCCTTCCTCTCCGTG
GTTCTGAGGGTGGTCCGCGAGGAGGACCCGGTCAAGCCCCCCGTCCGTCTCGACTCTCGAGAGGCGACGCATGCC
ATCTTCGCCTCCATGTGGACTCCCGTCATCATGCTGCTGCTCGGTGGCTTCACCCTCGCCGCCGCGCTGTCCAAG
TGCACCATCGACAAGCGGCTCGCCACGCTCATCCTCAGCAAGGCCGGCACTCGGCCGCGGACGGTGCTGGTGGCC
AACATGTTTGTCGCCGCCTTTGCTTCCATGCTCATCAGCAATGTGGCCGCTCCTGTTCTCTGCTACTCCATCATC
GAGCCGATGCTGCGGACGCTGCCATCCGACTCGGACATGTCAAAGGCCATCATCATCGGCATCGCCCTGGCGTCC
AACATTGGCGGCATGCTCTCGCCCATCGCCTCTCCGCAGAACGTGGTGGCCATGGGCATCATGGACCCAGAGCCG
ACCTGGCTGCAGTGGTTCTTCATCGTCATTCCCGTCGGCGCCGTCTCGCTGCTGCTCATCTGGCTGCTGCTCCTC
GTCACCTTTCAGCCCGGCAAGGGCACCGTCATCGTCCCGATCCGGCCGCTCAAGGAACCGTTTACGGGCGTGCAG
TGGTTCGTGTCGCTCGTTGCCATTGCCACGGTGGCCTTGTGGTGCGCCAGCCACCAGATGGAGGGCGTCTTTGGC
GACATGGGAGTCATCGCCATCATGCCCATTGTCCTGTTCTTCGGCATCGGCATCCTCACCAAGGAGGACTTTAAC
AACTTTCCCTGGACCATCATCATCCTGGCTGCTGGCGGGCTGTCGCTGGGTAAAGCGGTGCGTTCGTCGGGGTTG
TTGCACGTCTTCGCCGAGGTGGTGTCGGATAATGTCGAGGGCATGAGCCTTTACGGCATTCTCTTCGTCTTCTCG
ACGCTGATACTCGTCATCGCCACTTTTATCAGCCATACGGTTGCGGCCCTCATCTTTCTGCCGCTGGTGTACGAC
GTGGGCGCGGCCATGGACCAGCCGCAGCCGAACCTGCTCGTCATGGGCGGTGTTCTCATGTGCAGCGCGGCCATG
GGTCTGCCTACGAGTGGCTTCCCCAACATGAGTATGTTTCCATCCCTGACGAGAGCTGGATGTGCGTGGCTGACG
AGATGTAGCTGCTATTATGAAGGAGGATGCTGCGGGGCAGAGATATCTGCGCGTGAAGCATTTCATTACCAGGGG
TGTGCCGAGCAGTGTCATTACGCTGGTGGTTGTCATGACGCTTGGGTTTGGGATCATGGAGGTTGCTGGCTTGGA
TTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail