Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4813
Gene name
LocationContig_452:5621..10078
Strand-
Gene length (bp)4457
Transcript length (bp)3633
Coding sequence length (bp)3633
Protein length (aa) 1211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10366 Vps39_1 Vacuolar sorting protein 39 domain 1 1.6E-32 764 870
PF10367 Vps39_2 Vacuolar sorting protein 39 domain 2 8.8E-26 1069 1191
PF00780 CNH CNH domain 1.6E-15 236 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13955|VAM6_SCHPO Vacuolar morphogenesis protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vam6 PE=3 SV=1 151 1189 3.0E-62
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 690 1189 4.0E-46
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 690 1189 2.0E-45
sp|Q07468|VAM6_YEAST Vacuolar morphogenesis protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAM6 PE=1 SV=1 705 1189 8.0E-28
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 151 594 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13955|VAM6_SCHPO Vacuolar morphogenesis protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vam6 PE=3 SV=1 151 1189 3.0E-62
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 690 1189 4.0E-46
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 690 1189 2.0E-45
sp|Q07468|VAM6_YEAST Vacuolar morphogenesis protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAM6 PE=1 SV=1 705 1189 8.0E-28
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 151 594 1.0E-25
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 151 594 4.0E-25
sp|A4IG72|TGFA1_DANRE Transforming growth factor-beta receptor-associated protein 1 homolog OS=Danio rerio GN=tgfbrap1 PE=2 SV=1 732 1192 4.0E-20
sp|Q8WUH2|TGFA1_HUMAN Transforming growth factor-beta receptor-associated protein 1 OS=Homo sapiens GN=TGFBRAP1 PE=1 SV=1 690 1189 3.0E-19
sp|Q3UR70|TGFA1_MOUSE Transforming growth factor-beta receptor-associated protein 1 OS=Mus musculus GN=Tgfbrap1 PE=1 SV=1 690 1205 6.0E-18
sp|A7MB11|TGFA1_BOVIN Transforming growth factor-beta receptor-associated protein 1 OS=Bos taurus GN=TGFBRAP1 PE=2 SV=1 738 1189 5.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4813
MPSRAAIASRPNAHSTNAAMSAATTNDPKPFPTGPSTRRVSEAEARTAQGRSRTNKPRGTSPSSLIHARKATASA
GYSSILNEALARQEARVEVLRFYADGLEQLSQSCMDKSALHRRVTRSLDETLMAAFRNAAASLSSRSRSRLDRSV
MLSAFTARPIIELRPRDKSRIETILAYGDRILVGLNSGALRVYRLNELSTPTDHPPDSQEVQAQHGNDSAVPSTT
KPTDLLREVDKFSSRAIEQLAIIKEANIIISLSNYHVSLHDLQTYELIETLSRSRNASCFAVTSNIVKDPDTSIP
EIISRLAVAVKRRLLLWSWHESELHDDVGEIVLSESIRTVTWASATKLVCGMNGGYVMVDSVTHEVEDIVSPGMV
GAGTQGSRFGAVSSAGMGYMGLGGYMPRPLAAKLANDEMLLAKDINTLFIKADGKPLDRRQIPWPSAPESIGFSY
PYILALQPPSKGFLEVRNPDTLSLLQSISLPGAAQLHFPPPTVSLAHAGKGFHISSERCVWKMAATDYDSQVEEL
VDGHSFDEAISVLNMLEDALLKNKKETLREVKMLKAEMLFKKRKHRQAMDLMNEDDVQAPPERVLRLFPPQISGE
LSRWAHQDGDGGDEVVAVKKPNGPVPEGSEGLADHLMMHNPIGGFAKLFRASSKKGPSDAASVASVKKDAADEDD
TESAKESSATEDRPLEGKDLVKAVLELNSYLAGTRARLQRVLDPVTGKLKPRSDRQESTEEAAERFLRTTQSESE
QRLETELRATFKLVDTTLFRSYMLSQPSLASSLFRIPNFCDPDVVNEKLLEHNRFTELVDFFYGKKLHKEALQLL
YKFGSATKPDEAAPTLHGPDRSIQYLQSLPPSEMDLILEHAAWTLASNPDYAMEIFVGDTENAETLPRDRVVAFL
QSIDTKLERQYLEHIINELDDMTPDFHNRLVDLYVKNLGATSKGPEWDGLMAKFIRFLRSSRQVYSLTKALGLIP
RDDAAFSEARAVVLSNMGEHREALEIYVFRMKDYAKAEEYCNRLYKAQEATRSSAADSPASLAPEDPAKSIYHTL
LSLYLKPPATHKQQLEPALDLLSKHGSRLPASSTLGLVPDDLPVRALEAYFRGRIRSVNSHVNESRIVAGLRKAE
GISVAARLHLGDDAAGGQGGRNRHVTISDERHCVVCHKKLGGAMRIGGSVVAVLPDNTAVHYGCLNRATGQKADR
LQAPSWARGG*
Coding >Ophun1|4813
ATGCCCTCACGAGCAGCCATCGCTTCGCGCCCCAACGCGCATTCCACGAATGCAGCCATGTCTGCCGCCACGACC
AACGACCCTAAGCCGTTCCCGACTGGCCCGTCTACGCGACGCGTGAGCGAGGCAGAGGCCAGGACCGCGCAGGGA
AGATCGCGCACTAATAAACCACGAGGCACGTCTCCGTCGTCCTTAATCCACGCCCGCAAGGCAACTGCCTCGGCG
GGTTACTCGTCGATTCTCAATGAAGCGCTGGCCCGCCAGGAAGCGCGCGTTGAGGTCCTCCGGTTCTACGCGGAC
GGCCTCGAGCAGCTCAGCCAGAGCTGCATGGACAAATCGGCTCTCCACCGCCGGGTGACCCGGAGCCTCGACGAG
ACCCTGATGGCAGCCTTCAGGAATGCCGCCGCGTCTCTTTCATCGCGGTCTCGGTCACGCCTTGACAGAAGCGTC
ATGCTATCCGCCTTCACCGCCCGGCCCATCATCGAGCTGCGGCCACGAGACAAGTCCCGGATCGAGACCATCCTC
GCATACGGCGATCGCATTCTCGTCGGGCTCAACAGCGGCGCCCTCCGTGTCTATCGGCTCAACGAGCTCTCTACC
CCGACCGATCATCCTCCGGACTCGCAGGAAGTCCAAGCTCAGCATGGAAACGACTCCGCGGTACCATCTACGACG
AAGCCCACGGATCTGTTGCGCGAGGTCGACAAGTTCTCGAGCCGCGCCATAGAGCAGCTAGCCATCATCAAGGAA
GCCAACATCATCATATCCCTCTCCAACTACCACGTCTCTCTCCACGACCTACAGACATACGAGCTCATCGAAACC
CTCAGTCGCTCCCGGAACGCTTCCTGCTTCGCCGTAACCTCCAATATCGTCAAGGACCCCGACACCAGCATACCA
GAGATCATCAGCCGGCTCGCCGTTGCCGTCAAGCGTCGTCTTCTTCTCTGGAGCTGGCATGAAAGCGAGCTTCAC
GACGATGTCGGCGAGATTGTTCTCTCCGAGTCGATCCGAACCGTCACTTGGGCTAGCGCGACCAAGCTCGTGTGC
GGCATGAACGGCGGTTATGTCATGGTCGACTCCGTCACCCACGAGGTCGAGGACATCGTCAGTCCCGGCATGGTG
GGCGCCGGCACCCAGGGCAGCCGCTTCGGCGCCGTCAGCAGCGCCGGAATGGGCTACATGGGGCTGGGAGGATAT
ATGCCGAGGCCGCTCGCCGCCAAGCTGGCCAACGATGAGATGCTCCTGGCCAAGGACATCAACACGCTCTTCATC
AAGGCCGACGGAAAGCCGCTGGATAGGCGTCAGATACCCTGGCCATCTGCTCCAGAGTCCATCGGCTTCTCCTAT
CCCTATATCCTGGCCCTTCAGCCGCCGTCCAAGGGCTTCCTCGAGGTTCGCAACCCAGACACCTTGTCCCTTCTC
CAGAGCATCTCGCTCCCCGGCGCCGCTCAGCTTCACTTCCCTCCGCCTACAGTGAGCCTCGCGCACGCAGGCAAG
GGCTTTCACATCTCAAGCGAGCGCTGCGTGTGGAAGATGGCGGCGACGGATTACGACTCCCAGGTGGAGGAGCTT
GTAGATGGTCACTCGTTCGACGAGGCCATCAGCGTACTCAACATGCTCGAAGACGCCCTTCTCAAGAACAAAAAG
GAGACGCTTCGGGAGGTCAAGATGCTCAAGGCCGAGATGCTTTTTAAGAAGAGGAAACATCGGCAAGCGATGGAC
CTGATGAACGAGGATGACGTGCAAGCACCGCCAGAGAGGGTGCTGAGGCTCTTTCCGCCCCAGATATCCGGAGAG
TTGTCCCGTTGGGCTCATCAGGATGGAGACGGGGGCGATGAGGTGGTTGCCGTCAAGAAGCCGAACGGGCCAGTC
CCAGAAGGCTCAGAGGGACTGGCCGACCATCTGATGATGCACAATCCCATAGGCGGCTTCGCCAAGCTGTTCAGG
GCTTCTAGTAAGAAGGGCCCCTCAGACGCGGCTTCAGTCGCCTCGGTCAAGAAGGATGCCGCGGACGAGGACGAT
ACGGAGAGCGCAAAGGAGTCGTCTGCCACCGAGGACCGGCCTCTCGAGGGCAAGGACCTGGTTAAGGCGGTTCTG
GAGCTCAACAGCTACCTGGCGGGAACTCGGGCCCGGCTGCAGAGGGTCCTCGATCCGGTGACGGGCAAGCTGAAG
CCCCGGTCAGACAGACAGGAATCGACGGAAGAAGCGGCCGAGCGGTTCTTGAGAACGACGCAGAGCGAGTCGGAG
CAGAGGCTCGAGACGGAGCTTCGCGCCACCTTTAAACTGGTTGACACAACCCTGTTTCGCTCCTACATGCTGTCG
CAACCATCGCTGGCGAGCTCGCTGTTCCGGATTCCCAACTTTTGCGACCCAGATGTGGTCAACGAGAAGCTCCTG
GAACACAACAGGTTCACGGAACTGGTTGATTTCTTCTACGGCAAGAAGCTGCACAAGGAGGCCCTACAGCTCCTT
TACAAGTTCGGATCGGCCACGAAGCCCGACGAAGCAGCGCCGACGCTCCATGGGCCCGACCGGTCCATCCAGTAT
CTGCAGAGCCTGCCGCCGTCGGAGATGGATCTCATCTTGGAGCACGCAGCCTGGACGCTGGCTAGCAACCCCGAT
TATGCCATGGAGATTTTCGTCGGCGACACGGAGAACGCCGAGACGCTGCCGCGAGACAGGGTCGTAGCCTTTCTT
CAGAGCATCGATACGAAGCTCGAGAGGCAGTATCTGGAGCACATCATCAACGAGCTCGACGACATGACGCCCGAC
TTCCACAACCGCCTGGTGGACTTGTACGTGAAGAACCTCGGGGCCACGAGCAAGGGGCCGGAGTGGGACGGGCTC
ATGGCCAAGTTCATCCGGTTCCTGCGAAGCTCTCGTCAGGTCTACAGCCTGACCAAGGCGCTTGGACTGATTCCC
AGGGATGATGCAGCATTCTCCGAGGCCCGGGCTGTTGTGCTCAGCAACATGGGGGAGCATAGAGAAGCGCTGGAG
ATTTACGTCTTCAGGATGAAAGACTATGCCAAGGCTGAGGAATACTGCAACCGCCTGTACAAGGCGCAGGAAGCT
ACTCGGTCGTCGGCGGCAGACAGTCCCGCGTCTCTGGCCCCTGAAGACCCGGCCAAGTCCATCTACCACACGCTG
TTGTCGCTGTACCTTAAGCCGCCAGCCACCCACAAGCAGCAGCTCGAGCCGGCGCTGGATCTCCTGTCCAAGCAC
GGGTCCAGACTCCCTGCCTCGTCAACCCTCGGCCTGGTGCCTGACGATCTGCCGGTCAGGGCTCTCGAGGCCTAC
TTCCGAGGCCGCATCCGATCAGTGAATAGCCACGTCAACGAGTCCCGAATCGTCGCCGGGTTGCGCAAGGCCGAG
GGCATCTCCGTCGCGGCCCGGTTGCATCTCGGCGACGACGCGGCCGGCGGACAAGGTGGGCGCAATCGCCACGTC
ACAATCAGCGACGAGAGGCACTGCGTCGTCTGTCACAAGAAGCTCGGCGGCGCCATGCGCATCGGCGGAAGCGTC
GTTGCTGTCTTGCCTGACAACACGGCTGTGCACTATGGCTGCCTTAACAGGGCGACCGGGCAGAAAGCAGACAGG
CTGCAGGCGCCAAGCTGGGCAAGGGGCGGTTGA
Transcript >Ophun1|4813
ATGCCCTCACGAGCAGCCATCGCTTCGCGCCCCAACGCGCATTCCACGAATGCAGCCATGTCTGCCGCCACGACC
AACGACCCTAAGCCGTTCCCGACTGGCCCGTCTACGCGACGCGTGAGCGAGGCAGAGGCCAGGACCGCGCAGGGA
AGATCGCGCACTAATAAACCACGAGGCACGTCTCCGTCGTCCTTAATCCACGCCCGCAAGGCAACTGCCTCGGCG
GGTTACTCGTCGATTCTCAATGAAGCGCTGGCCCGCCAGGAAGCGCGCGTTGAGGTCCTCCGGTTCTACGCGGAC
GGCCTCGAGCAGCTCAGCCAGAGCTGCATGGACAAATCGGCTCTCCACCGCCGGGTGACCCGGAGCCTCGACGAG
ACCCTGATGGCAGCCTTCAGGAATGCCGCCGCGTCTCTTTCATCGCGGTCTCGGTCACGCCTTGACAGAAGCGTC
ATGCTATCCGCCTTCACCGCCCGGCCCATCATCGAGCTGCGGCCACGAGACAAGTCCCGGATCGAGACCATCCTC
GCATACGGCGATCGCATTCTCGTCGGGCTCAACAGCGGCGCCCTCCGTGTCTATCGGCTCAACGAGCTCTCTACC
CCGACCGATCATCCTCCGGACTCGCAGGAAGTCCAAGCTCAGCATGGAAACGACTCCGCGGTACCATCTACGACG
AAGCCCACGGATCTGTTGCGCGAGGTCGACAAGTTCTCGAGCCGCGCCATAGAGCAGCTAGCCATCATCAAGGAA
GCCAACATCATCATATCCCTCTCCAACTACCACGTCTCTCTCCACGACCTACAGACATACGAGCTCATCGAAACC
CTCAGTCGCTCCCGGAACGCTTCCTGCTTCGCCGTAACCTCCAATATCGTCAAGGACCCCGACACCAGCATACCA
GAGATCATCAGCCGGCTCGCCGTTGCCGTCAAGCGTCGTCTTCTTCTCTGGAGCTGGCATGAAAGCGAGCTTCAC
GACGATGTCGGCGAGATTGTTCTCTCCGAGTCGATCCGAACCGTCACTTGGGCTAGCGCGACCAAGCTCGTGTGC
GGCATGAACGGCGGTTATGTCATGGTCGACTCCGTCACCCACGAGGTCGAGGACATCGTCAGTCCCGGCATGGTG
GGCGCCGGCACCCAGGGCAGCCGCTTCGGCGCCGTCAGCAGCGCCGGAATGGGCTACATGGGGCTGGGAGGATAT
ATGCCGAGGCCGCTCGCCGCCAAGCTGGCCAACGATGAGATGCTCCTGGCCAAGGACATCAACACGCTCTTCATC
AAGGCCGACGGAAAGCCGCTGGATAGGCGTCAGATACCCTGGCCATCTGCTCCAGAGTCCATCGGCTTCTCCTAT
CCCTATATCCTGGCCCTTCAGCCGCCGTCCAAGGGCTTCCTCGAGGTTCGCAACCCAGACACCTTGTCCCTTCTC
CAGAGCATCTCGCTCCCCGGCGCCGCTCAGCTTCACTTCCCTCCGCCTACAGTGAGCCTCGCGCACGCAGGCAAG
GGCTTTCACATCTCAAGCGAGCGCTGCGTGTGGAAGATGGCGGCGACGGATTACGACTCCCAGGTGGAGGAGCTT
GTAGATGGTCACTCGTTCGACGAGGCCATCAGCGTACTCAACATGCTCGAAGACGCCCTTCTCAAGAACAAAAAG
GAGACGCTTCGGGAGGTCAAGATGCTCAAGGCCGAGATGCTTTTTAAGAAGAGGAAACATCGGCAAGCGATGGAC
CTGATGAACGAGGATGACGTGCAAGCACCGCCAGAGAGGGTGCTGAGGCTCTTTCCGCCCCAGATATCCGGAGAG
TTGTCCCGTTGGGCTCATCAGGATGGAGACGGGGGCGATGAGGTGGTTGCCGTCAAGAAGCCGAACGGGCCAGTC
CCAGAAGGCTCAGAGGGACTGGCCGACCATCTGATGATGCACAATCCCATAGGCGGCTTCGCCAAGCTGTTCAGG
GCTTCTAGTAAGAAGGGCCCCTCAGACGCGGCTTCAGTCGCCTCGGTCAAGAAGGATGCCGCGGACGAGGACGAT
ACGGAGAGCGCAAAGGAGTCGTCTGCCACCGAGGACCGGCCTCTCGAGGGCAAGGACCTGGTTAAGGCGGTTCTG
GAGCTCAACAGCTACCTGGCGGGAACTCGGGCCCGGCTGCAGAGGGTCCTCGATCCGGTGACGGGCAAGCTGAAG
CCCCGGTCAGACAGACAGGAATCGACGGAAGAAGCGGCCGAGCGGTTCTTGAGAACGACGCAGAGCGAGTCGGAG
CAGAGGCTCGAGACGGAGCTTCGCGCCACCTTTAAACTGGTTGACACAACCCTGTTTCGCTCCTACATGCTGTCG
CAACCATCGCTGGCGAGCTCGCTGTTCCGGATTCCCAACTTTTGCGACCCAGATGTGGTCAACGAGAAGCTCCTG
GAACACAACAGGTTCACGGAACTGGTTGATTTCTTCTACGGCAAGAAGCTGCACAAGGAGGCCCTACAGCTCCTT
TACAAGTTCGGATCGGCCACGAAGCCCGACGAAGCAGCGCCGACGCTCCATGGGCCCGACCGGTCCATCCAGTAT
CTGCAGAGCCTGCCGCCGTCGGAGATGGATCTCATCTTGGAGCACGCAGCCTGGACGCTGGCTAGCAACCCCGAT
TATGCCATGGAGATTTTCGTCGGCGACACGGAGAACGCCGAGACGCTGCCGCGAGACAGGGTCGTAGCCTTTCTT
CAGAGCATCGATACGAAGCTCGAGAGGCAGTATCTGGAGCACATCATCAACGAGCTCGACGACATGACGCCCGAC
TTCCACAACCGCCTGGTGGACTTGTACGTGAAGAACCTCGGGGCCACGAGCAAGGGGCCGGAGTGGGACGGGCTC
ATGGCCAAGTTCATCCGGTTCCTGCGAAGCTCTCGTCAGGTCTACAGCCTGACCAAGGCGCTTGGACTGATTCCC
AGGGATGATGCAGCATTCTCCGAGGCCCGGGCTGTTGTGCTCAGCAACATGGGGGAGCATAGAGAAGCGCTGGAG
ATTTACGTCTTCAGGATGAAAGACTATGCCAAGGCTGAGGAATACTGCAACCGCCTGTACAAGGCGCAGGAAGCT
ACTCGGTCGTCGGCGGCAGACAGTCCCGCGTCTCTGGCCCCTGAAGACCCGGCCAAGTCCATCTACCACACGCTG
TTGTCGCTGTACCTTAAGCCGCCAGCCACCCACAAGCAGCAGCTCGAGCCGGCGCTGGATCTCCTGTCCAAGCAC
GGGTCCAGACTCCCTGCCTCGTCAACCCTCGGCCTGGTGCCTGACGATCTGCCGGTCAGGGCTCTCGAGGCCTAC
TTCCGAGGCCGCATCCGATCAGTGAATAGCCACGTCAACGAGTCCCGAATCGTCGCCGGGTTGCGCAAGGCCGAG
GGCATCTCCGTCGCGGCCCGGTTGCATCTCGGCGACGACGCGGCCGGCGGACAAGGTGGGCGCAATCGCCACGTC
ACAATCAGCGACGAGAGGCACTGCGTCGTCTGTCACAAGAAGCTCGGCGGCGCCATGCGCATCGGCGGAAGCGTC
GTTGCTGTCTTGCCTGACAACACGGCTGTGCACTATGGCTGCCTTAACAGGGCGACCGGGCAGAAAGCAGACAGG
CTGCAGGCGCCAAGCTGGGCAAGGGGCGGTTGA
Gene >Ophun1|4813
ATGCCCTCACGAGCAGCCATCGCTTCGCGCCCCAACGCGCATTCCACGAATGCAGCCATGTCTGCCGCCACGACC
AACGACCCTAAGCCGTTCCCGACTGGCCCGTCTACGCGACGCGTGAGCGAGGCAGAGGCCAGGACCGCGCAGGGA
AGATCGCGCACTAATAAACCACGAGGCACGTCTCCGTCGTCCTTAATCCACGCCCGCAAGGCAACTGCCTCGGCG
GGTTACTCGTCGATTCTCAATGAAGCGCTGGCCCGCCAGGAAGCGCGCGTTGAGGTCCTCCGGTTCTACGCGGAC
GGCCTCGAGCAGCTCAGCCAGAGCTGCATGGACAAATCGGCTCTCCACCGCCGGGTGACCCGGAGCCTCGACGAG
ACCCTGATGGCAGCCTTCAGGAATGCCGCCGCGTCTCTTTCATCGCGGTCTCGGTCACGCCTTGACAGAAGGTCG
TTAGGAAGATCACATGGCCGGTTGCCGCAAGAAACGGAGCGACTACTATTTCAACCGAATACGGCGCTCGGTAGT
CCTCTCGTTAAGCAAGAGAGAGAAAAAGAGGACAAGGCAAGAAGGTGAGGGACATGTTCCTCCCTCGAATACATC
GTTTGCAGATTCACCTATATCCTACCTACCTACTTTTGATGCTCTTCGACACACATCTCGCCCACGCTCTACGGT
AGAGACAATAGTTGTTGAGAAGGGGCTTTCCCAGTCTCTATGTTCTGTAACAATATCTCTTTTGGCAGGTCTAGA
CAGCTTCTTGATCAGAGGCTATCTCTTCGGTCTATTTGAGCACCTAGACAACCTCTTTCGTAACCAAGTTATCCA
ATTTATCATCTGAACAACTACGTAGCAAGGAAGGAGTCCAGCTGTGCTATTTCACGAGTTTGCCTTGCTGCCTCT
CACATCTCAATGTCCACGTGATGCCAAGCTCGTCTTCATCACGTGATATCCTTGCCGCACTTCCCTGCCGGCAAT
GACACCATCATATCGCCCAAGCCAGCTTCTTCAGCCACCATCGTCCCTCAACTCGGGGCTTCAAACCACCAAAAC
TCAGTCATGGGCTGACGTGTCTTCGCTAACAAGACGCTCCGTCACCTGATCCCAGCGTCATGCTATCCGCCTTCA
CCGCCCGGCCCATCATCGAGCTGCGGCCACGAGACAAGTCCCGGATCGAGACCATCCTCGCATACGGTAGATGGT
CCTTGCCCTAGCTTCTCACTGTATTGGATGCTGACGAAGTAGTCCCAGGCGATCGCATTCTCGTCGGGCTCAACA
GCGGCGCCCTCCGTGTCTATCGGCTCAACGAGCTCTCTACCCCGACCGATCATCCTCCGGACTCGCAGGAAGTCC
AAGCTCAGCATGGAAACGACTCCGCGGTACCATCTACGACGAAGCCCACGGATCTGTTGCGCGAGGTCGACAAGT
TCTCGAGCCGCGCCATAGAGCAGCTAGCCATCATCAAGGAAGCCAACATCATCATATCCCTCTCCAACTACCACG
TCTCTCTCCACGACCTACAGACATACGAGCTCATCGAAACCCTCAGTCGCTCCCGGAACGCTTCCTGCTTCGCCG
TAACCTCCAATATCGTCAAGGACCCCGACACCAGCATACCAGAGATCATCAGCCGGCTCGCCGTTGCCGTCAAGC
GTCGTCTTCTTCTCTGGAGCTGGCATGAAAGCGAGCTTCACGACGATGTCGGCGAGATTGTTCTCTCCGAGTCGA
TCCGAACCGTCACTTGGGCTAGCGCGACCAAGCTCGTGTGCGGCATGAACGGCGGTTATGTCATGGTCGACTCCG
TCACCCACGAGGTCGAGGACATCGTCAGTCCCGGCATGGTGGGCGCCGGCACCCAGGGCAGCCGCTTCGGCGCCG
TCAGCAGCGCCGGAATGGGCTACATGGGGCTGGGAGGATATATGCCGAGGCCGCTCGCCGCCAAGCTGGCCAACG
ATGAGATGCTCCTGGCCAAGGACATCAACACGCTCTTCATCAAGGCCGACGGAAAGCCGCTGGATAGGCGTCAGA
TACCCTGGCCATCTGCTCCAGAGTCCATCGGCTTCTCCTATCCCTATATCCTGGCCCTTCAGCCGCCGTCCAAGG
GCTTCCTCGAGGTTCGCAACCCAGACACCTTGTCCCTTCTCCAGAGCATCTCGCTCCCCGGCGCCGCTCAGCTTC
ACTTCCCTCCGCCTACAGTGAGCCTCGCGCACGCAGGCAAGGGCTTTCACATCTCAAGCGAGCGCTGCGTGTGGA
AGATGGCGGCGACGGATTACGACTCCCAGGTGGAGGAGCTTGTAGATGGTCACTCGTTCGACGAGGCCATCAGCG
TACTCAACATGCTCGAAGACGCCCTTCTCAAGAACAAAAAGGAGACGCTTCGGGAGGTCAAGATGCTCAAGGCCG
AGATGCTTTTTAAGAAGAGGAAACATCGGCAAGCGATGGACCTGATGAACGAGGATGACGTGCAAGCACCGCCAG
AGAGGGTGCTGAGGCTCTTTCCGCCCCAGATATCCGGAGAGTTGTCCCGTTGGGCTCATCAGGATGGAGACGGGG
GCGATGAGGTGGTTGCCGTCAAGAAGCCGAACGGGCCAGTCCCAGAAGGCTCAGAGGGACTGGCCGACCATCTGA
TGATGCACAATCCCATAGGCGGCTTCGCCAAGCTGTTCAGGGCTTCTAGTAAGAAGGGCCCCTCAGACGCGGCTT
CAGTCGCCTCGGTCAAGAAGGATGCCGCGGACGAGGACGATACGGAGAGCGCAAAGGAGTCGTCTGCCACCGAGG
ACCGGCCTCTCGAGGGCAAGGACCTGGTTAAGGCGGTTCTGGAGCTCAACAGCTACCTGGCGGGAACTCGGGCCC
GGCTGCAGAGGGTCCTCGATCCGGTGACGGGCAAGCTGAAGCCCCGGTCAGACAGACAGGAATCGACGGAAGAAG
CGGCCGAGCGGTTCTTGAGAACGACGCAGAGCGAGTCGGAGCAGAGGCTCGAGACGGAGCTTCGCGCCACCTTTA
AACTGGTTGACACAACCCTGTTTCGCTCCTACATGCTGTCGCAACCATCGCTGGCGAGCTCGCTGTTCCGGATTC
CCAACTTTTGCGACCCAGATGTGGTCAACGAGAAGCTCCTGGAACACAACAGGTTCACGGAACTGGTTGATTTCT
TCTACGGCAAGAAGCTGCACAAGGAGGCCCTACAGCTCCTTTACAAGTTCGGATCGGCCACGAAGCCCGACGAAG
CAGCGCCGACGCTCCATGGGCCCGACCGGTCCATCCAGTATCTGCAGAGCCTGCCGCCGTCGGAGATGGATCTCA
TCTTGGAGCACGCAGCCTGGACGCTGGCTAGCAACCCCGATTATGCCATGGAGATTTTCGTCGGCGACACGGAGA
ACGCCGAGACGCTGCCGCGAGACAGGGTCGTAGCCTTTCTTCAGAGCATCGATACGAAGCTCGAGAGGCAGTATC
TGGAGCACATCATCAACGAGCTCGACGACATGACGCCCGACTTCCACAACCGCCTGGTGGACTTGTACGTGAAGA
ACCTCGGGGCCACGAGCAAGGGGCCGGAGTGGGACGGGCTCATGGCCAAGTTCATCCGGTTCCTGCGAAGCTCTC
GTCAGGTCTACAGCCTGACCAAGGCGCTTGGACTGATTCCCAGGGATGGTGAGTCGGGCAAGATGAGAGATTGGA
AGCGGCTGAGGAGCGCTGACTCGCTTGAACAGATGCAGCATTCTCCGAGGCCCGGGCTGTTGTGCTCAGCAACAT
GGGGGAGCATAGAGAAGCGCTGGAGATTTACGTCTTCAGGATGAAAGACTATGCCAAGGCTGAGGAGTGAGTCCC
TGTCCTTGTCTGAGCTCCATTTTCTAACGAGAACTGGCAGATACTGCAACCGCCTGTACAAGGCGCAGGAAGCTA
CTCGGTCGTCGGCGGCAGACAGTCCCGCGTCTCTGGCCCCTGAAGACCCGGCCAAGTCCATCTACCACACGCTGT
TGTCGCTGTACCTTAAGCCGCCAGCCACCCACAAGCAGCAGCTCGAGCCGGCGCTGGATCTCCTGTCCAAGCACG
GGTCCAGACTCCCTGCCTCGTCAACCCTCGGCCTGGTGCCTGACGATCTGCCGGTCAGGGCTCTCGAGGCCTACT
TCCGAGGCCGCATCCGATCAGTGAATAGCCACGTCAACGAGTCCCGAATCGTCGCCGGGTTGCGCAAGGCCGAGG
GCATCTCCGTCGCGGCCCGGTTGCATCTCGGCGACGACGCGGCCGGCGGACAAGGTGGGCGCAATCGCCACGTCA
CAATCAGCGACGAGAGGCACTGCGTCGTCTGTCACAAGAAGCTCGGCGGCGCCATGCGCATCGGCGGAAGCGTCG
TTGCTGTCTTGCCTGACAACACGGCTGTGCACTATGGCTGCCTTAACAGGGCGACCGGGCAGAAAGCAGACAGGC
TGCAGGCGCCAAGCTGGGCAAGGGGCGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail