Protein ID | Ophun1|4801 |
Gene name | |
Location | Contig_450:7616..8905 |
Strand | - |
Gene length (bp) | 1289 |
Transcript length (bp) | 1233 |
Coding sequence length (bp) | 1233 |
Protein length (aa) | 411 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00591 | Glycos_transf_3 | Glycosyl transferase family, a/b domain | 2.8E-57 | 107 | 393 |
PF02885 | Glycos_trans_3N | Glycosyl transferase family, helical bundle domain | 3.6E-11 | 17 | 79 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O60122|TRPD_SCHPO | Anthranilate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp4 PE=3 SV=1 | 26 | 406 | 1.0E-65 |
sp|P07285|TRPD_YEAST | Anthranilate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP4 PE=1 SV=1 | 50 | 402 | 1.0E-52 |
sp|A5UMC1|TRPD_METS3 | Anthranilate phosphoribosyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=trpD PE=3 SV=1 | 15 | 405 | 3.0E-48 |
sp|B1Z9R9|TRPD_METPB | Anthranilate phosphoribosyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=trpD PE=3 SV=1 | 106 | 405 | 9.0E-48 |
sp|A9W900|TRPD_METEP | Anthranilate phosphoribosyltransferase OS=Methylobacterium extorquens (strain PA1) GN=trpD PE=3 SV=1 | 84 | 405 | 2.0E-47 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O60122|TRPD_SCHPO | Anthranilate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp4 PE=3 SV=1 | 26 | 406 | 1.0E-65 |
sp|P07285|TRPD_YEAST | Anthranilate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP4 PE=1 SV=1 | 50 | 402 | 1.0E-52 |
sp|A5UMC1|TRPD_METS3 | Anthranilate phosphoribosyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=trpD PE=3 SV=1 | 15 | 405 | 3.0E-48 |
sp|B1Z9R9|TRPD_METPB | Anthranilate phosphoribosyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=trpD PE=3 SV=1 | 106 | 405 | 9.0E-48 |
sp|A9W900|TRPD_METEP | Anthranilate phosphoribosyltransferase OS=Methylobacterium extorquens (strain PA1) GN=trpD PE=3 SV=1 | 84 | 405 | 2.0E-47 |
sp|B7KUV9|TRPD_METC4 | Anthranilate phosphoribosyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=trpD PE=3 SV=1 | 84 | 405 | 3.0E-47 |
sp|A9BHQ6|TRPD_PETMO | Anthranilate phosphoribosyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=trpD PE=3 SV=1 | 26 | 405 | 1.0E-46 |
sp|A7INK3|TRPD_XANP2 | Anthranilate phosphoribosyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=trpD PE=3 SV=1 | 12 | 407 | 6.0E-46 |
sp|C4Z111|TRPD_EUBE2 | Anthranilate phosphoribosyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=trpD PE=3 SV=1 | 15 | 406 | 4.0E-45 |
sp|B0U7Z5|TRPD_METS4 | Anthranilate phosphoribosyltransferase OS=Methylobacterium sp. (strain 4-46) GN=trpD PE=3 SV=1 | 12 | 405 | 1.0E-44 |
sp|O66576|TRPD_AQUAE | Anthranilate phosphoribosyltransferase OS=Aquifex aeolicus (strain VF5) GN=trpD PE=3 SV=1 | 15 | 407 | 8.0E-43 |
sp|A0AJ83|TRPD_LISW6 | Anthranilate phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpD PE=3 SV=1 | 105 | 410 | 2.0E-42 |
sp|Q92B78|TRPD_LISIN | Anthranilate phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpD PE=3 SV=1 | 105 | 410 | 3.0E-42 |
sp|Q8Y6Q3|TRPD_LISMO | Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpD PE=3 SV=1 | 105 | 410 | 3.0E-42 |
sp|Q71Z37|TRPD_LISMF | Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpD PE=3 SV=1 | 105 | 410 | 7.0E-42 |
sp|C1KVS8|TRPD_LISMC | Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpD PE=3 SV=1 | 105 | 410 | 7.0E-42 |
sp|B8DHB1|TRPD_LISMH | Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpD PE=3 SV=1 | 105 | 410 | 1.0E-41 |
sp|Q07NF5|TRPD_RHOP5 | Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=trpD PE=3 SV=1 | 12 | 349 | 1.0E-41 |
sp|Q2IWB1|TRPD_RHOP2 | Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=trpD PE=3 SV=2 | 12 | 404 | 1.0E-41 |
sp|Q0C1A1|TRPD_HYPNA | Anthranilate phosphoribosyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=trpD PE=3 SV=1 | 83 | 406 | 2.0E-41 |
sp|Q1AU89|TRPD_RUBXD | Anthranilate phosphoribosyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=trpD PE=3 SV=1 | 106 | 410 | 4.0E-41 |
sp|B3W6W9|TRPD_LACCB | Anthranilate phosphoribosyltransferase OS=Lactobacillus casei (strain BL23) GN=trpD PE=3 SV=1 | 32 | 348 | 7.0E-41 |
sp|P17170|TRPD_LACCA | Anthranilate phosphoribosyltransferase OS=Lactobacillus casei GN=trpD PE=3 SV=1 | 32 | 348 | 8.0E-41 |
sp|A8I839|TRPD_AZOC5 | Anthranilate phosphoribosyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=trpD PE=3 SV=1 | 12 | 407 | 2.0E-40 |
sp|B1XSZ2|TRPD_POLNS | Anthranilate phosphoribosyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=trpD PE=3 SV=1 | 107 | 405 | 2.0E-40 |
sp|B0K2U2|TRPD_THEPX | Anthranilate phosphoribosyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=trpD PE=3 SV=1 | 120 | 393 | 8.0E-40 |
sp|B0K8T3|TRPD_THEP3 | Anthranilate phosphoribosyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=trpD PE=3 SV=1 | 120 | 393 | 8.0E-40 |
sp|Q03CY0|TRPD_LACC3 | Anthranilate phosphoribosyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=trpD PE=3 SV=1 | 32 | 348 | 9.0E-40 |
sp|Q57686|TRPD_METJA | Anthranilate phosphoribosyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpD PE=3 SV=1 | 107 | 406 | 1.0E-39 |
sp|Q82Y74|TRPD_NITEU | Anthranilate phosphoribosyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=trpD PE=3 SV=1 | 73 | 407 | 1.0E-39 |
sp|Q6N5T0|TRPD_RHOPA | Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=trpD PE=3 SV=1 | 12 | 404 | 2.0E-39 |
sp|B3Q6M8|TRPD_RHOPT | Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=trpD PE=3 SV=1 | 12 | 404 | 2.0E-39 |
sp|Q88WI3|TRPD_LACPL | Anthranilate phosphoribosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=trpD PE=3 SV=1 | 108 | 348 | 2.0E-39 |
sp|P18261|TRPD_BACPU | Anthranilate phosphoribosyltransferase OS=Bacillus pumilus GN=trpD PE=3 SV=1 | 107 | 353 | 3.0E-39 |
sp|B8IP99|TRPD_METNO | Anthranilate phosphoribosyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=trpD PE=3 SV=1 | 12 | 325 | 3.0E-39 |
sp|B9KXB8|TRPD_THERP | Anthranilate phosphoribosyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=trpD PE=3 SV=1 | 15 | 325 | 3.0E-39 |
sp|P94326|TRPD_BRADU | Anthranilate phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=trpD PE=3 SV=1 | 12 | 349 | 3.0E-39 |
sp|B1M5Q2|TRPD_METRJ | Anthranilate phosphoribosyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=trpD PE=3 SV=1 | 12 | 340 | 9.0E-39 |
sp|Q3AXD5|TRPD_SYNS9 | Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain CC9902) GN=trpD PE=3 SV=1 | 23 | 350 | 1.0E-38 |
sp|A9B148|TRPD_HERA2 | Anthranilate phosphoribosyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=trpD PE=3 SV=1 | 28 | 325 | 1.0E-38 |
sp|C0QR68|TRPD_PERMH | Anthranilate phosphoribosyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=trpD PE=3 SV=1 | 15 | 353 | 1.0E-38 |
sp|Q9KCB3|TRPD_BACHD | Anthranilate phosphoribosyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=trpD PE=3 SV=1 | 31 | 345 | 1.0E-38 |
sp|C4ZI69|TRPD_EUBR3 | Anthranilate phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=trpD PE=3 SV=1 | 15 | 405 | 2.0E-38 |
sp|Q3ZZ15|TRPD_DEHMC | Anthranilate phosphoribosyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpD PE=3 SV=1 | 107 | 409 | 2.0E-38 |
sp|Q3Z6G6|TRPD_DEHM1 | Anthranilate phosphoribosyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpD PE=3 SV=1 | 107 | 409 | 2.0E-38 |
sp|B8I0U9|TRPD_CLOCE | Anthranilate phosphoribosyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=trpD PE=3 SV=1 | 27 | 410 | 2.0E-38 |
sp|B3GY52|TRPD_ACTP7 | Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=trpD PE=3 SV=1 | 34 | 345 | 2.0E-38 |
sp|Q8R9M6|TRPD_CALS4 | Anthranilate phosphoribosyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpD PE=3 SV=1 | 120 | 403 | 2.0E-38 |
sp|Q0I9N0|TRPD_SYNS3 | Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain CC9311) GN=trpD PE=3 SV=1 | 17 | 392 | 2.0E-38 |
sp|A6U9C4|TRPD_SINMW | Anthranilate phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=trpD PE=3 SV=1 | 12 | 349 | 3.0E-38 |
sp|Q9YGB4|TRPD_THEKO | Anthranilate phosphoribosyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpD PE=3 SV=1 | 105 | 352 | 3.0E-38 |
sp|Q9V1G4|TRPD_PYRAB | Anthranilate phosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpD PE=3 SV=1 | 105 | 352 | 4.0E-38 |
sp|A8ZZX1|TRPD_DESOH | Anthranilate phosphoribosyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=trpD PE=3 SV=1 | 27 | 408 | 4.0E-38 |
sp|C6DYM5|TRPD_GEOSM | Anthranilate phosphoribosyltransferase OS=Geobacter sp. (strain M21) GN=trpD PE=3 SV=1 | 107 | 406 | 5.0E-38 |
sp|B5EBU6|TRPD_GEOBB | Anthranilate phosphoribosyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=trpD PE=3 SV=1 | 107 | 406 | 6.0E-38 |
sp|Q8TXJ5|TRPD_METKA | Anthranilate phosphoribosyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trpD PE=3 SV=1 | 107 | 404 | 7.0E-38 |
sp|B1GZB9|TRPD_UNCTG | Anthranilate phosphoribosyltransferase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=trpD PE=3 SV=1 | 28 | 406 | 9.0E-38 |
sp|A3DDS8|TRPD_CLOTH | Anthranilate phosphoribosyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=trpD PE=3 SV=1 | 15 | 405 | 1.0E-37 |
sp|B0BQA6|TRPD_ACTPJ | Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=trpD PE=3 SV=1 | 34 | 345 | 1.0E-37 |
sp|Q3IKY4|TRPD_PSEHT | Anthranilate phosphoribosyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=trpD PE=3 SV=1 | 34 | 405 | 1.0E-37 |
sp|Q92PS0|TRPD_RHIME | Anthranilate phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=trpD PE=3 SV=1 | 106 | 405 | 1.0E-37 |
sp|B4SE13|TRPD_PELPB | Anthranilate phosphoribosyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=trpD PE=3 SV=1 | 108 | 410 | 1.0E-37 |
sp|A3N1G7|TRPD_ACTP2 | Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=trpD PE=3 SV=1 | 34 | 345 | 1.0E-37 |
sp|C4LC91|TRPD_TOLAT | Anthranilate phosphoribosyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=trpD PE=3 SV=1 | 107 | 352 | 1.0E-37 |
sp|B7HGZ8|TRPD_BACC4 | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain B4264) GN=trpD PE=3 SV=1 | 65 | 406 | 2.0E-37 |
sp|Q15RZ7|TRPD_PSEA6 | Anthranilate phosphoribosyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=trpD PE=3 SV=1 | 17 | 352 | 2.0E-37 |
sp|B8FA41|TRPD_DESAA | Anthranilate phosphoribosyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=trpD PE=3 SV=1 | 107 | 408 | 2.0E-37 |
sp|Q215B8|TRPD_RHOPB | Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=trpD PE=3 SV=1 | 12 | 329 | 2.0E-37 |
sp|B7IM73|TRPD_BACC2 | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain G9842) GN=trpD PE=3 SV=1 | 65 | 406 | 4.0E-37 |
sp|B9LEV9|TRPD_CHLSY | Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=trpD PE=3 SV=1 | 27 | 346 | 4.0E-37 |
sp|A9WCH7|TRPD_CHLAA | Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trpD PE=3 SV=1 | 27 | 346 | 4.0E-37 |
sp|Q9RTJ5|TRPD_DEIRA | Anthranilate phosphoribosyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpD PE=3 SV=2 | 90 | 398 | 4.0E-37 |
sp|Q5QX82|TRPD_IDILO | Anthranilate phosphoribosyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=trpD PE=3 SV=1 | 25 | 349 | 4.0E-37 |
sp|A1W2Z7|TRPD_ACISJ | Anthranilate phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=trpD PE=3 SV=1 | 107 | 409 | 4.0E-37 |
sp|B9MBS3|TRPD_ACIET | Anthranilate phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=trpD PE=3 SV=1 | 107 | 409 | 4.0E-37 |
sp|B4S5K5|TRPD_PROA2 | Anthranilate phosphoribosyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=trpD PE=3 SV=1 | 109 | 410 | 5.0E-37 |
sp|Q74AH4|TRPD_GEOSL | Anthranilate phosphoribosyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=trpD PE=3 SV=1 | 107 | 406 | 6.0E-37 |
sp|Q3SRJ4|TRPD_NITWN | Anthranilate phosphoribosyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=trpD PE=3 SV=1 | 12 | 326 | 6.0E-37 |
sp|Q8UER8|TRPD_AGRFC | Anthranilate phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=trpD PE=3 SV=1 | 12 | 358 | 6.0E-37 |
sp|A9VJV9|TRPD_BACWK | Anthranilate phosphoribosyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=trpD PE=3 SV=1 | 65 | 406 | 7.0E-37 |
sp|B4SLE9|TRPD_STRM5 | Anthranilate phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=trpD PE=3 SV=1 | 107 | 407 | 1.0E-36 |
sp|Q67PJ9|TRPD_SYMTH | Anthranilate phosphoribosyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=trpD PE=3 SV=1 | 15 | 407 | 1.0E-36 |
sp|B3QUY6|TRPD_CHLT3 | Anthranilate phosphoribosyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=trpD PE=3 SV=1 | 109 | 402 | 1.0E-36 |
sp|Q3ABS0|TRPD_CARHZ | Anthranilate phosphoribosyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=trpD PE=3 SV=1 | 15 | 407 | 1.0E-36 |
sp|A4VHK0|TRPD_PSEU5 | Anthranilate phosphoribosyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=trpD PE=3 SV=1 | 13 | 404 | 1.0E-36 |
sp|Q97EF2|TRPD_CLOAB | Anthranilate phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=trpD PE=3 SV=1 | 120 | 401 | 1.0E-36 |
sp|B2FKL2|TRPD_STRMK | Anthranilate phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=trpD PE=3 SV=1 | 107 | 407 | 2.0E-36 |
sp|B0CGT8|TRPD_BRUSI | Anthranilate phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=trpD PE=3 SV=1 | 12 | 406 | 2.0E-36 |
sp|Q63ED0|TRPD_BACCZ | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=trpD PE=3 SV=1 | 67 | 367 | 2.0E-36 |
sp|Q6AMS5|TRPD_DESPS | Anthranilate phosphoribosyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=trpD PE=3 SV=1 | 107 | 329 | 2.0E-36 |
sp|A5EK24|TRPD_BRASB | Anthranilate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=trpD PE=3 SV=1 | 12 | 325 | 2.0E-36 |
sp|Q0AJP9|TRPD_NITEC | Anthranilate phosphoribosyltransferase OS=Nitrosomonas eutropha (strain C91) GN=trpD PE=3 SV=1 | 107 | 407 | 2.0E-36 |
sp|A6VNT3|TRPD_ACTSZ | Anthranilate phosphoribosyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=trpD PE=3 SV=1 | 107 | 349 | 3.0E-36 |
sp|A9AAU1|TRPD_METM6 | Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=trpD PE=3 SV=1 | 72 | 403 | 3.0E-36 |
sp|Q65TF2|TRPD_MANSM | Anthranilate phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=trpD PE=3 SV=1 | 107 | 349 | 3.0E-36 |
sp|A9KL44|TRPD_CLOPH | Anthranilate phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=trpD PE=3 SV=1 | 29 | 345 | 3.0E-36 |
sp|Q6LPA6|TRPD_PHOPR | Anthranilate phosphoribosyltransferase OS=Photobacterium profundum GN=trpD PE=3 SV=1 | 107 | 349 | 4.0E-36 |
sp|B2V751|TRPD_SULSY | Anthranilate phosphoribosyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=trpD PE=3 SV=1 | 109 | 353 | 4.0E-36 |
sp|Q8U089|TRPD_PYRFU | Anthranilate phosphoribosyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpD PE=3 SV=1 | 105 | 351 | 5.0E-36 |
sp|B3EMT4|TRPD_CHLPB | Anthranilate phosphoribosyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=trpD PE=3 SV=1 | 16 | 410 | 6.0E-36 |
sp|Q73BR0|TRPD_BACC1 | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=trpD PE=3 SV=1 | 67 | 406 | 6.0E-36 |
sp|Q5KXU8|TRPD_GEOKA | Anthranilate phosphoribosyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=trpD PE=3 SV=1 | 15 | 352 | 6.0E-36 |
sp|Q6HLU7|TRPD_BACHK | Anthranilate phosphoribosyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=trpD PE=3 SV=1 | 67 | 367 | 8.0E-36 |
sp|A0RB61|TRPD_BACAH | Anthranilate phosphoribosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=trpD PE=3 SV=1 | 67 | 367 | 9.0E-36 |
sp|B7JES7|TRPD_BACC0 | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain AH820) GN=trpD PE=3 SV=1 | 67 | 367 | 9.0E-36 |
sp|Q81TM1|TRPD_BACAN | Anthranilate phosphoribosyltransferase OS=Bacillus anthracis GN=trpD PE=3 SV=1 | 67 | 367 | 9.0E-36 |
sp|C3LAW1|TRPD_BACAC | Anthranilate phosphoribosyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=trpD PE=3 SV=1 | 67 | 367 | 9.0E-36 |
sp|C3P3T7|TRPD_BACAA | Anthranilate phosphoribosyltransferase OS=Bacillus anthracis (strain A0248) GN=trpD PE=3 SV=1 | 67 | 367 | 9.0E-36 |
sp|P20575|TRPD_PSEPU | Anthranilate phosphoribosyltransferase OS=Pseudomonas putida GN=trpD PE=3 SV=1 | 13 | 313 | 1.0E-35 |
sp|B9IU35|TRPD_BACCQ | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain Q1) GN=trpD PE=3 SV=1 | 67 | 367 | 1.0E-35 |
sp|B7I0E9|TRPD_BACC7 | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain AH187) GN=trpD PE=3 SV=1 | 67 | 367 | 1.0E-35 |
sp|C1ELE7|TRPD_BACC3 | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain 03BB102) GN=trpD PE=3 SV=1 | 67 | 367 | 1.0E-35 |
sp|Q2RT49|TRPD_RHORT | Anthranilate phosphoribosyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=trpD PE=3 SV=1 | 1 | 325 | 1.0E-35 |
sp|Q47YC2|TRPD_COLP3 | Anthranilate phosphoribosyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=trpD PE=3 SV=1 | 99 | 357 | 1.0E-35 |
sp|A6VFU3|TRPD_METM7 | Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=trpD PE=3 SV=1 | 72 | 403 | 1.0E-35 |
sp|Q9KST4|TRPD_VIBCH | Anthranilate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpD PE=3 SV=2 | 107 | 349 | 1.0E-35 |
sp|A5F210|TRPD_VIBC3 | Anthranilate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=trpD PE=3 SV=1 | 107 | 349 | 1.0E-35 |
sp|Q39SQ6|TRPD_GEOMG | Anthranilate phosphoribosyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=trpD PE=3 SV=1 | 107 | 406 | 1.0E-35 |
sp|A8FEK1|TRPD_BACP2 | Anthranilate phosphoribosyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=trpD PE=3 SV=1 | 67 | 353 | 1.0E-35 |
sp|P22096|TRPD_VIBPA | Anthranilate phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpD PE=3 SV=1 | 107 | 349 | 1.0E-35 |
sp|Q1IJR5|TRPD_KORVE | Anthranilate phosphoribosyltransferase OS=Koribacter versatilis (strain Ellin345) GN=trpD PE=3 SV=1 | 27 | 326 | 1.0E-35 |
sp|B3PLP1|TRPD_CELJU | Anthranilate phosphoribosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=trpD PE=3 SV=1 | 13 | 351 | 2.0E-35 |
sp|Q11HU2|TRPD_CHESB | Anthranilate phosphoribosyltransferase OS=Chelativorans sp. (strain BNC1) GN=trpD PE=3 SV=1 | 108 | 405 | 2.0E-35 |
sp|Q136D3|TRPD_RHOPS | Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=trpD PE=3 SV=1 | 12 | 325 | 2.0E-35 |
sp|A4YVD5|TRPD_BRASO | Anthranilate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=trpD PE=3 SV=2 | 12 | 325 | 2.0E-35 |
sp|Q123F3|TRPD_POLSJ | Anthranilate phosphoribosyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=trpD PE=3 SV=1 | 107 | 409 | 2.0E-35 |
sp|C1CMD6|TRPD_STRZP | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=trpD PE=3 SV=1 | 15 | 397 | 2.0E-35 |
sp|B5E7M6|TRPD_STRP4 | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=trpD PE=3 SV=1 | 15 | 397 | 2.0E-35 |
sp|C3MCF3|TRPD_RHISN | Anthranilate phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=trpD PE=3 SV=1 | 108 | 349 | 2.0E-35 |
sp|B6JG28|TRPD_OLICO | Anthranilate phosphoribosyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=trpD PE=3 SV=1 | 12 | 349 | 3.0E-35 |
sp|B5ZPY6|TRPD_RHILW | Anthranilate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=trpD PE=3 SV=1 | 12 | 352 | 3.0E-35 |
sp|Q1GHJ3|TRPD_RUEST | Anthranilate phosphoribosyltransferase OS=Ruegeria sp. (strain TM1040) GN=trpD PE=3 SV=1 | 109 | 406 | 3.0E-35 |
sp|B9JFD7|TRPD_AGRRK | Anthranilate phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=trpD PE=3 SV=1 | 12 | 352 | 4.0E-35 |
sp|B8G5C5|TRPD_CHLAD | Anthranilate phosphoribosyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=trpD PE=3 SV=1 | 27 | 326 | 4.0E-35 |
sp|C1CG45|TRPD_STRZJ | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=trpD PE=3 SV=1 | 15 | 397 | 4.0E-35 |
sp|P67000|TRPD_STRR6 | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpD PE=3 SV=1 | 15 | 397 | 4.0E-35 |
sp|B2ISS4|TRPD_STRPS | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=trpD PE=3 SV=1 | 15 | 397 | 4.0E-35 |
sp|P66999|TRPD_STRPN | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpD PE=3 SV=1 | 15 | 397 | 4.0E-35 |
sp|B1I7T0|TRPD_STRPI | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=trpD PE=3 SV=1 | 15 | 397 | 4.0E-35 |
sp|C1C969|TRPD_STRP7 | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=trpD PE=3 SV=1 | 15 | 397 | 4.0E-35 |
sp|Q04IY6|TRPD_STRP2 | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=trpD PE=3 SV=1 | 15 | 397 | 4.0E-35 |
sp|Q1QMJ8|TRPD_NITHX | Anthranilate phosphoribosyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=trpD PE=3 SV=1 | 12 | 325 | 4.0E-35 |
sp|A4J146|TRPD_DESRM | Anthranilate phosphoribosyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=trpD PE=3 SV=1 | 26 | 350 | 5.0E-35 |
sp|Q02166|TRPD_ARATH | Anthranilate phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1 | 45 | 405 | 5.0E-35 |
sp|A9BS05|TRPD_DELAS | Anthranilate phosphoribosyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=trpD PE=3 SV=1 | 107 | 404 | 5.0E-35 |
sp|Q5V211|TRPD_HALMA | Anthranilate phosphoribosyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpD PE=3 SV=1 | 35 | 401 | 5.0E-35 |
sp|Q81GG8|TRPD_BACCR | Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=trpD PE=3 SV=1 | 67 | 406 | 6.0E-35 |
sp|Q2K880|TRPD_RHIEC | Anthranilate phosphoribosyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=trpD PE=3 SV=1 | 12 | 352 | 6.0E-35 |
sp|C1CT54|TRPD_STRZT | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=trpD PE=3 SV=1 | 15 | 397 | 7.0E-35 |
sp|B8ZN62|TRPD_STRPJ | Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=trpD PE=3 SV=1 | 15 | 397 | 7.0E-35 |
sp|A1WYT2|TRPD_HALHL | Anthranilate phosphoribosyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=trpD PE=3 SV=1 | 27 | 407 | 8.0E-35 |
sp|B3E5V8|TRPD_GEOLS | Anthranilate phosphoribosyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=trpD PE=3 SV=1 | 107 | 351 | 9.0E-35 |
sp|A5VQR4|TRPD_BRUO2 | Anthranilate phosphoribosyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=trpD PE=3 SV=2 | 12 | 406 | 1.0E-34 |
sp|A6LU93|TRPD_CLOB8 | Anthranilate phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=trpD PE=3 SV=1 | 27 | 400 | 1.0E-34 |
sp|C5D3D7|TRPD_GEOSW | Anthranilate phosphoribosyltransferase OS=Geobacillus sp. (strain WCH70) GN=trpD PE=3 SV=1 | 109 | 398 | 1.0E-34 |
sp|A5VXL4|TRPD_PSEP1 | Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=trpD PE=3 SV=1 | 13 | 303 | 1.0E-34 |
sp|Q7MM54|TRPD_VIBVY | Anthranilate phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=trpD PE=3 SV=2 | 41 | 349 | 1.0E-34 |
sp|B3Q0L2|TRPD_RHIE6 | Anthranilate phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=trpD PE=3 SV=1 | 12 | 352 | 1.0E-34 |
sp|B3EH38|TRPD_CHLL2 | Anthranilate phosphoribosyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=trpD PE=3 SV=1 | 109 | 410 | 2.0E-34 |
sp|A6UW21|TRPD_META3 | Anthranilate phosphoribosyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=trpD PE=3 SV=2 | 104 | 398 | 2.0E-34 |
sp|Q6LYI4|TRPD_METMP | Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=trpD PE=3 SV=1 | 72 | 403 | 2.0E-34 |
sp|Q88QR7|TRPD_PSEPK | Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain KT2440) GN=trpD PE=3 SV=1 | 13 | 303 | 2.0E-34 |
sp|Q8YHF7|TRPD_BRUME | Anthranilate phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=trpD PE=3 SV=2 | 12 | 406 | 2.0E-34 |
sp|C0RJB0|TRPD_BRUMB | Anthranilate phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=trpD PE=3 SV=1 | 12 | 406 | 2.0E-34 |
sp|Q57CZ9|TRPD_BRUAB | Anthranilate phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=trpD PE=3 SV=1 | 12 | 406 | 2.0E-34 |
sp|Q2YRR5|TRPD_BRUA2 | Anthranilate phosphoribosyltransferase OS=Brucella abortus (strain 2308) GN=trpD PE=3 SV=1 | 12 | 406 | 2.0E-34 |
sp|B2S5Z0|TRPD_BRUA1 | Anthranilate phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=trpD PE=3 SV=1 | 12 | 406 | 2.0E-34 |
sp|A4SFZ6|TRPD_CHLPM | Anthranilate phosphoribosyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=trpD PE=3 SV=1 | 109 | 326 | 2.0E-34 |
sp|Q3K5V3|TRPD_PSEPF | Anthranilate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=trpD PE=3 SV=1 | 13 | 398 | 2.0E-34 |
sp|A8MDL8|TRPD_CALMQ | Anthranilate phosphoribosyltransferase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=trpD PE=3 SV=1 | 15 | 349 | 2.0E-34 |
sp|B1JE35|TRPD_PSEPW | Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain W619) GN=trpD PE=3 SV=1 | 13 | 313 | 2.0E-34 |
sp|Q03WZ9|TRPD_LEUMM | Anthranilate phosphoribosyltransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=trpD PE=3 SV=1 | 108 | 348 | 2.0E-34 |
sp|Q4ZML2|TRPD_PSEU2 | Anthranilate phosphoribosyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=trpD PE=3 SV=1 | 13 | 303 | 2.0E-34 |
sp|Q2NFE4|TRPD_METST | Anthranilate phosphoribosyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=trpD PE=3 SV=1 | 15 | 406 | 2.0E-34 |
sp|Q1MGE2|TRPD_RHIL3 | Anthranilate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=trpD PE=3 SV=1 | 109 | 352 | 2.0E-34 |
sp|A5GTM6|TRPD_SYNR3 | Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain RCC307) GN=trpD PE=3 SV=1 | 107 | 408 | 2.0E-34 |
sp|B0KJB2|TRPD_PSEPG | Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain GB-1) GN=trpD PE=3 SV=1 | 13 | 313 | 3.0E-34 |
sp|Q48NP8|TRPD_PSE14 | Anthranilate phosphoribosyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=trpD PE=3 SV=1 | 13 | 303 | 3.0E-34 |
sp|Q9X6J5|TRPD_GEOSE | Anthranilate phosphoribosyltransferase OS=Geobacillus stearothermophilus GN=trpD PE=3 SV=1 | 15 | 378 | 4.0E-34 |
sp|A7MRZ7|TRPD_VIBCB | Anthranilate phosphoribosyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=trpD PE=3 SV=1 | 107 | 395 | 4.0E-34 |
sp|Q8D8B4|TRPD_VIBVU | Anthranilate phosphoribosyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=trpD PE=3 SV=1 | 92 | 349 | 5.0E-34 |
sp|A0KMC8|TRPD_AERHH | Anthranilate phosphoribosyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=trpD PE=3 SV=1 | 107 | 349 | 5.0E-34 |
sp|Q8G0F5|TRPD_BRUSU | Anthranilate phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=trpD PE=3 SV=1 | 12 | 406 | 6.0E-34 |
sp|A4SKT3|TRPD_AERS4 | Anthranilate phosphoribosyltransferase OS=Aeromonas salmonicida (strain A449) GN=trpD PE=3 SV=1 | 107 | 349 | 6.0E-34 |
sp|A5UT95|TRPD_ROSS1 | Anthranilate phosphoribosyltransferase OS=Roseiflexus sp. (strain RS-1) GN=trpD PE=3 SV=1 | 26 | 326 | 6.0E-34 |
sp|B2SL02|TRPD_XANOP | Anthranilate phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=trpD PE=3 SV=1 | 27 | 410 | 6.0E-34 |
sp|Q2NYD6|TRPD_XANOM | Anthranilate phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=trpD PE=3 SV=1 | 27 | 410 | 6.0E-34 |
sp|P57856|TRPD_PASMU | Anthranilate phosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=trpD PE=3 SV=1 | 107 | 349 | 7.0E-34 |
sp|Q03JB8|TRPD_STRTD | Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=trpD PE=3 SV=1 | 27 | 403 | 7.0E-34 |
sp|A7Z619|TRPD_BACMF | Anthranilate phosphoribosyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=trpD PE=3 SV=1 | 83 | 407 | 7.0E-34 |
sp|B8EJS2|TRPD_METSB | Anthranilate phosphoribosyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=trpD PE=3 SV=1 | 12 | 325 | 7.0E-34 |
sp|Q1IG00|TRPD_PSEE4 | Anthranilate phosphoribosyltransferase OS=Pseudomonas entomophila (strain L48) GN=trpD PE=3 SV=1 | 13 | 303 | 8.0E-34 |
sp|P03947|TRPD_BACSU | Anthranilate phosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=trpD PE=3 SV=2 | 83 | 407 | 9.0E-34 |
sp|Q5F7H5|TRPD_NEIG1 | Anthranilate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpD PE=3 SV=1 | 32 | 407 | 1.0E-33 |
sp|Q9PGT6|TRPD_XYLFA | Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=trpD PE=3 SV=1 | 107 | 352 | 1.0E-33 |
sp|A5GKM1|TRPD_SYNPW | Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain WH7803) GN=trpD PE=3 SV=1 | 91 | 350 | 1.0E-33 |
sp|Q5M347|TRPD_STRT2 | Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=trpD PE=3 SV=1 | 27 | 403 | 1.0E-33 |
sp|A7I4T7|TRPD_METB6 | Anthranilate phosphoribosyltransferase OS=Methanoregula boonei (strain 6A8) GN=trpD PE=3 SV=1 | 26 | 404 | 1.0E-33 |
sp|A9M4G6|TRPD_NEIM0 | Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=trpD PE=3 SV=1 | 32 | 401 | 1.0E-33 |
sp|Q2JQ65|TRPD_SYNJB | Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=trpD PE=3 SV=1 | 44 | 405 | 1.0E-33 |
sp|B9JX63|TRPD_AGRVS | Anthranilate phosphoribosyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=trpD PE=3 SV=1 | 12 | 359 | 1.0E-33 |
sp|Q2JWL5|TRPD_SYNJA | Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=trpD PE=3 SV=1 | 31 | 402 | 1.0E-33 |
sp|B4RBX4|TRPD_PHEZH | Anthranilate phosphoribosyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=trpD PE=3 SV=1 | 109 | 404 | 1.0E-33 |
sp|B2IKP4|TRPD_BEII9 | Anthranilate phosphoribosyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=trpD PE=3 SV=1 | 12 | 329 | 2.0E-33 |
sp|A4IQ85|TRPD_GEOTN | Anthranilate phosphoribosyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=trpD PE=3 SV=1 | 15 | 349 | 2.0E-33 |
sp|C3PKY4|TRPD_CORA7 | Anthranilate phosphoribosyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=trpD PE=3 SV=1 | 104 | 353 | 2.0E-33 |
sp|A1KTN4|TRPD_NEIMF | Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpD PE=3 SV=1 | 106 | 401 | 2.0E-33 |
sp|P66995|TRPD_NEIMB | Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpD PE=3 SV=1 | 106 | 401 | 2.0E-33 |
sp|P66994|TRPD_NEIMA | Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpD PE=3 SV=1 | 106 | 401 | 2.0E-33 |
sp|Q21MR4|TRPD_SACD2 | Anthranilate phosphoribosyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=trpD PE=3 SV=1 | 13 | 404 | 2.0E-33 |
sp|Q1GYF5|TRPD_METFK | Anthranilate phosphoribosyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=trpD PE=3 SV=1 | 107 | 398 | 2.0E-33 |
sp|A3PHK8|TRPD_RHOS1 | Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=trpD PE=3 SV=1 | 15 | 325 | 2.0E-33 |
sp|A9M5F3|TRPD_BRUC2 | Anthranilate phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=trpD PE=3 SV=1 | 12 | 406 | 2.0E-33 |
sp|A6UP19|TRPD_METVS | Anthranilate phosphoribosyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=trpD PE=3 SV=1 | 105 | 403 | 3.0E-33 |
sp|B0U1N9|TRPD_XYLFM | Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain M12) GN=trpD PE=3 SV=1 | 107 | 352 | 3.0E-33 |
sp|A4SV53|TRPD_POLSQ | Anthranilate phosphoribosyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=trpD PE=3 SV=1 | 107 | 351 | 3.0E-33 |
sp|A8AW02|TRPD_STRGC | Anthranilate phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpD PE=3 SV=1 | 15 | 340 | 3.0E-33 |
sp|Q5LYI4|TRPD_STRT1 | Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=trpD PE=3 SV=1 | 27 | 403 | 3.0E-33 |
sp|P43858|TRPD_HAEIN | Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpD PE=3 SV=1 | 107 | 349 | 3.0E-33 |
sp|A4WX68|TRPD_RHOS5 | Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=trpD PE=3 SV=1 | 15 | 325 | 3.0E-33 |
sp|Q0APU5|TRPD_MARMM | Anthranilate phosphoribosyltransferase OS=Maricaulis maris (strain MCS10) GN=trpD PE=3 SV=1 | 106 | 365 | 4.0E-33 |
sp|A5GES2|TRPD_GEOUR | Anthranilate phosphoribosyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=trpD PE=3 SV=1 | 15 | 406 | 4.0E-33 |
sp|A4FXH2|TRPD_METM5 | Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=trpD PE=3 SV=1 | 72 | 403 | 4.0E-33 |
sp|Q88A04|TRPD_PSESM | Anthranilate phosphoribosyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trpD PE=3 SV=1 | 13 | 303 | 4.0E-33 |
sp|Q8XS00|TRPD2_RALSO | Anthranilate phosphoribosyltransferase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=trpD2 PE=3 SV=1 | 74 | 358 | 4.0E-33 |
sp|Q3IQ38|TRPD_NATPD | Anthranilate phosphoribosyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=trpD PE=3 SV=1 | 92 | 359 | 5.0E-33 |
sp|A1U6H0|TRPD_MARHV | Anthranilate phosphoribosyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=trpD PE=3 SV=1 | 13 | 405 | 5.0E-33 |
sp|B9KMV1|TRPD_RHOSK | Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=trpD PE=3 SV=1 | 15 | 325 | 5.0E-33 |
sp|Q9ZFA8|TRPD_RHOS4 | Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpD PE=3 SV=1 | 15 | 325 | 5.0E-33 |
sp|A8LMJ6|TRPD_DINSH | Anthranilate phosphoribosyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=trpD PE=3 SV=1 | 106 | 329 | 7.0E-33 |
sp|B8F815|TRPD_HAEPS | Anthranilate phosphoribosyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=trpD PE=3 SV=1 | 107 | 349 | 7.0E-33 |
sp|B7JX56|TRPD_CYAP8 | Anthranilate phosphoribosyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=trpD PE=3 SV=1 | 76 | 351 | 8.0E-33 |
sp|O68608|TRPD1_STRCO | Anthranilate phosphoribosyltransferase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpD1 PE=3 SV=1 | 17 | 405 | 8.0E-33 |
sp|B1YLS1|TRPD_EXIS2 | Anthranilate phosphoribosyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=trpD PE=3 SV=1 | 15 | 398 | 8.0E-33 |
sp|Q4FM53|TRPD_PELUB | Anthranilate phosphoribosyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=trpD PE=3 SV=1 | 109 | 348 | 9.0E-33 |
sp|Q9A728|TRPD_CAUCR | Anthranilate phosphoribosyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=trpD PE=3 SV=1 | 107 | 405 | 9.0E-33 |
sp|B8GWP8|TRPD_CAUCN | Anthranilate phosphoribosyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=trpD PE=3 SV=1 | 107 | 405 | 9.0E-33 |
sp|B9M5M2|TRPD_GEODF | Anthranilate phosphoribosyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=trpD PE=3 SV=1 | 107 | 405 | 1.0E-32 |
sp|B3QM44|TRPD_CHLP8 | Anthranilate phosphoribosyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=trpD PE=3 SV=1 | 16 | 350 | 1.0E-32 |
sp|A4XZC6|TRPD_PSEMY | Anthranilate phosphoribosyltransferase OS=Pseudomonas mendocina (strain ymp) GN=trpD PE=3 SV=1 | 13 | 404 | 1.0E-32 |
sp|B0UU36|TRPD_HISS2 | Anthranilate phosphoribosyltransferase OS=Histophilus somni (strain 2336) GN=trpD PE=3 SV=1 | 16 | 349 | 1.0E-32 |
sp|A1KAT3|TRPD_AZOSB | Anthranilate phosphoribosyltransferase OS=Azoarcus sp. (strain BH72) GN=trpD PE=3 SV=1 | 107 | 408 | 1.0E-32 |
sp|A0LJ59|TRPD_SYNFM | Anthranilate phosphoribosyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=trpD PE=3 SV=1 | 28 | 406 | 1.0E-32 |
sp|Q7TTV4|TRPD_SYNPX | Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain WH8102) GN=trpD PE=3 SV=1 | 97 | 350 | 2.0E-32 |
sp|Q3BYB6|TRPD_XANC5 | Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=trpD PE=3 SV=1 | 107 | 410 | 2.0E-32 |
sp|B2JHI7|TRPD_BURP8 | Anthranilate phosphoribosyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=trpD PE=3 SV=1 | 58 | 406 | 2.0E-32 |
sp|Q24SK4|TRPD_DESHY | Anthranilate phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=trpD PE=3 SV=1 | 91 | 367 | 2.0E-32 |
sp|P06559|TRPD_CORGL | Anthranilate phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpD PE=3 SV=3 | 98 | 318 | 2.0E-32 |
sp|A4QI74|TRPD_CORGB | Anthranilate phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=trpD PE=3 SV=1 | 98 | 318 | 2.0E-32 |
sp|Q3J897|TRPD_NITOC | Anthranilate phosphoribosyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=trpD PE=3 SV=1 | 13 | 405 | 2.0E-32 |
sp|Q2Y5W9|TRPD_NITMU | Anthranilate phosphoribosyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=trpD PE=3 SV=1 | 107 | 405 | 2.0E-32 |
sp|Q112P2|TRPD_TRIEI | Anthranilate phosphoribosyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=trpD PE=3 SV=1 | 107 | 363 | 2.0E-32 |
sp|A7HXZ5|TRPD_PARL1 | Anthranilate phosphoribosyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=trpD PE=3 SV=1 | 139 | 367 | 2.0E-32 |
sp|Q8PD71|TRPD_XANCP | Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=trpD PE=1 SV=1 | 27 | 406 | 2.0E-32 |
sp|Q4UZF9|TRPD_XANC8 | Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=trpD PE=3 SV=1 | 27 | 406 | 2.0E-32 |
sp|Q87EX3|TRPD_XYLFT | Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=trpD PE=3 SV=1 | 27 | 352 | 3.0E-32 |
sp|B2I6S4|TRPD_XYLF2 | Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain M23) GN=trpD PE=3 SV=1 | 27 | 352 | 3.0E-32 |
sp|C5BPA3|TRPD_TERTT | Anthranilate phosphoribosyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=trpD PE=3 SV=1 | 13 | 307 | 3.0E-32 |
sp|A1BE13|TRPD_CHLPD | Anthranilate phosphoribosyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=trpD PE=3 SV=1 | 109 | 410 | 4.0E-32 |
sp|P73617|TRPD_SYNY3 | Anthranilate phosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpD PE=3 SV=1 | 107 | 347 | 4.0E-32 |
sp|Q8PQ48|TRPD_XANAC | Anthranilate phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=trpD PE=3 SV=1 | 27 | 410 | 4.0E-32 |
sp|A9B9W1|TRPD_PROM4 | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9211) GN=trpD PE=3 SV=1 | 107 | 352 | 4.0E-32 |
sp|Q7TV05|TRPD_PROMM | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=trpD PE=3 SV=1 | 107 | 384 | 4.0E-32 |
sp|A1STT2|TRPD_PSYIN | Anthranilate phosphoribosyltransferase OS=Psychromonas ingrahamii (strain 37) GN=trpD PE=3 SV=1 | 14 | 392 | 5.0E-32 |
sp|Q98ME4|TRPD_RHILO | Anthranilate phosphoribosyltransferase OS=Rhizobium loti (strain MAFF303099) GN=trpD PE=3 SV=1 | 84 | 349 | 5.0E-32 |
sp|B4EWH5|TRPD_PROMH | Anthranilate phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=trpD PE=3 SV=1 | 18 | 326 | 5.0E-32 |
sp|Q3A6L6|TRPD_PELCD | Anthranilate phosphoribosyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=trpD PE=3 SV=1 | 107 | 349 | 5.0E-32 |
sp|A5UEN6|TRPD_HAEIG | Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain PittGG) GN=trpD PE=3 SV=1 | 107 | 349 | 6.0E-32 |
sp|P00904|TRPGD_ECOLI | Bifunctional protein TrpGD OS=Escherichia coli (strain K12) GN=trpGD PE=1 SV=3 | 20 | 326 | 6.0E-32 |
sp|Q1QV38|TRPD_CHRSD | Anthranilate phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=trpD PE=3 SV=1 | 107 | 359 | 7.0E-32 |
sp|B8FVH5|TRPD_DESHD | Anthranilate phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=trpD PE=3 SV=1 | 106 | 367 | 8.0E-32 |
sp|B0VBS2|TRPD_ACIBY | Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain AYE) GN=trpD PE=3 SV=1 | 47 | 363 | 8.0E-32 |
sp|A3M784|TRPD_ACIBT | Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=trpD PE=3 SV=2 | 47 | 363 | 8.0E-32 |
sp|Q465F3|TRPD_METBF | Anthranilate phosphoribosyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=trpD PE=3 SV=1 | 84 | 369 | 9.0E-32 |
sp|P00905|TRPGD_SALTY | Bifunctional protein TrpGD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpGD PE=1 SV=4 | 15 | 326 | 9.0E-32 |
sp|A4Y843|TRPD_SHEPC | Anthranilate phosphoribosyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=trpD PE=3 SV=1 | 15 | 353 | 1.0E-31 |
sp|Q3B2H3|TRPD_CHLL7 | Anthranilate phosphoribosyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=trpD PE=3 SV=1 | 109 | 410 | 1.0E-31 |
sp|A5IG81|TRPD_LEGPC | Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Corby) GN=trpD PE=3 SV=1 | 15 | 395 | 1.0E-31 |
sp|Q4QKA1|TRPD_HAEI8 | Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=trpD PE=3 SV=1 | 107 | 349 | 1.0E-31 |
sp|A1S7I0|TRPD_SHEAM | Anthranilate phosphoribosyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=trpD PE=3 SV=1 | 105 | 359 | 1.0E-31 |
sp|Q0HWI1|TRPD_SHESR | Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain MR-7) GN=trpD PE=3 SV=1 | 15 | 353 | 1.0E-31 |
sp|P70936|TRPD_BACMQ | Anthranilate phosphoribosyltransferase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=trpD PE=3 SV=2 | 107 | 398 | 2.0E-31 |
sp|A3CLL8|TRPD_STRSV | Anthranilate phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=trpD PE=3 SV=1 | 15 | 340 | 2.0E-31 |
sp|A1B3Y5|TRPD_PARDP | Anthranilate phosphoribosyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=trpD PE=3 SV=1 | 10 | 309 | 2.0E-31 |
sp|Q6NEC1|TRPD_CORDI | Anthranilate phosphoribosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=trpD PE=3 SV=1 | 69 | 314 | 2.0E-31 |
sp|Q0HK79|TRPD_SHESM | Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain MR-4) GN=trpD PE=3 SV=1 | 14 | 353 | 2.0E-31 |
sp|B0VUS1|TRPD_ACIBS | Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain SDF) GN=trpD PE=3 SV=1 | 47 | 304 | 2.0E-31 |
sp|Q3APT3|TRPD_CHLCH | Anthranilate phosphoribosyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=trpD PE=3 SV=1 | 109 | 379 | 2.0E-31 |
sp|Q084N6|TRPD_SHEFN | Anthranilate phosphoribosyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=trpD PE=3 SV=1 | 12 | 353 | 2.0E-31 |
sp|B8GNI1|TRPD_THISH | Anthranilate phosphoribosyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=trpD PE=3 SV=1 | 28 | 404 | 2.0E-31 |
sp|A3CRK8|TRPD_METMJ | Anthranilate phosphoribosyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=trpD PE=3 SV=1 | 105 | 349 | 2.0E-31 |
sp|B0RMZ8|TRPD_XANCB | Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=trpD PE=3 SV=1 | 27 | 406 | 2.0E-31 |
sp|Q845X9|TRPD_BURM1 | Anthranilate phosphoribosyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=trpD PE=3 SV=1 | 58 | 406 | 2.0E-31 |
sp|Q6D4U2|TRPD_PECAS | Anthranilate phosphoribosyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=trpD PE=3 SV=1 | 92 | 326 | 3.0E-31 |
sp|A0KVD3|TRPD_SHESA | Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain ANA-3) GN=trpD PE=3 SV=1 | 14 | 353 | 3.0E-31 |
sp|C1D7P3|TRPD_LARHH | Anthranilate phosphoribosyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=trpD PE=3 SV=1 | 26 | 409 | 3.0E-31 |
sp|Q8TLP5|TRPD_METAC | Anthranilate phosphoribosyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=trpD PE=3 SV=1 | 107 | 369 | 3.0E-31 |
sp|Q163Y0|TRPD_ROSDO | Anthranilate phosphoribosyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=trpD PE=3 SV=2 | 106 | 329 | 3.0E-31 |
sp|B4E7A8|TRPD_BURCJ | Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=trpD PE=3 SV=1 | 58 | 406 | 3.0E-31 |
sp|Q8DVF6|TRPD_STRMU | Anthranilate phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpD PE=3 SV=1 | 33 | 400 | 4.0E-31 |
sp|B1JUU6|TRPD_BURCC | Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=trpD PE=3 SV=1 | 58 | 406 | 4.0E-31 |
sp|Q5ZX98|TRPD_LEGPH | Anthranilate phosphoribosyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=trpD PE=3 SV=1 | 15 | 393 | 4.0E-31 |
sp|Q5X6R9|TRPD_LEGPA | Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Paris) GN=trpD PE=3 SV=1 | 15 | 393 | 4.0E-31 |
sp|A6X0L1|TRPD_OCHA4 | Anthranilate phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=trpD PE=3 SV=1 | 12 | 406 | 4.0E-31 |
sp|Q1GUW8|TRPD_SPHAL | Anthranilate phosphoribosyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=trpD PE=3 SV=1 | 106 | 329 | 4.0E-31 |
sp|P59415|TRPD_BUCBP | Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpD PE=3 SV=1 | 76 | 349 | 5.0E-31 |
sp|A4JB68|TRPD_BURVG | Anthranilate phosphoribosyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=trpD PE=3 SV=1 | 58 | 406 | 5.0E-31 |
sp|Q1LIH4|TRPD_CUPMC | Anthranilate phosphoribosyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=trpD PE=3 SV=2 | 27 | 406 | 5.0E-31 |
sp|Q46WU8|TRPD_CUPPJ | Anthranilate phosphoribosyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=trpD PE=3 SV=1 | 3 | 406 | 5.0E-31 |
sp|Q9Z4W9|TRPD2_STRCO | Anthranilate phosphoribosyltransferase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpD2 PE=3 SV=1 | 83 | 351 | 6.0E-31 |
sp|A9F0C1|TRPD_SORC5 | Anthranilate phosphoribosyltransferase OS=Sorangium cellulosum (strain So ce56) GN=trpD PE=3 SV=1 | 25 | 352 | 6.0E-31 |
sp|Q4JWC7|TRPD_CORJK | Anthranilate phosphoribosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=trpD PE=3 SV=1 | 108 | 401 | 7.0E-31 |
sp|Q39JZ6|TRPD_BURL3 | Anthranilate phosphoribosyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=trpD PE=3 SV=1 | 58 | 406 | 8.0E-31 |
sp|C1DHY8|TRPD_AZOVD | Anthranilate phosphoribosyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=trpD PE=3 SV=1 | 13 | 404 | 8.0E-31 |
sp|A8GF80|TRPD_SERP5 | Anthranilate phosphoribosyltransferase OS=Serratia proteamaculans (strain 568) GN=trpD PE=3 SV=1 | 107 | 326 | 9.0E-31 |
sp|A5D1S5|TRPD_PELTS | Anthranilate phosphoribosyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=trpD PE=3 SV=1 | 15 | 349 | 9.0E-31 |
sp|A4TBH5|TRPD_MYCGI | Anthranilate phosphoribosyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=trpD PE=3 SV=1 | 25 | 407 | 1.0E-30 |
sp|A5N7N7|TRPD_CLOK5 | Anthranilate phosphoribosyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=trpD PE=3 SV=1 | 137 | 405 | 1.0E-30 |
sp|B9E148|TRPD_CLOK1 | Anthranilate phosphoribosyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=trpD PE=3 SV=1 | 137 | 405 | 1.0E-30 |
sp|A5CXR3|TRPD_VESOH | Anthranilate phosphoribosyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=trpD PE=3 SV=1 | 15 | 401 | 1.0E-30 |
sp|A0K459|TRPD_BURCH | Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=trpD PE=3 SV=2 | 58 | 406 | 1.0E-30 |
sp|Q1BSD3|TRPD_BURCA | Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=trpD PE=3 SV=2 | 58 | 406 | 1.0E-30 |
sp|A0R048|TRPD_MYCS2 | Anthranilate phosphoribosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=trpD PE=1 SV=1 | 1 | 400 | 1.0E-30 |
sp|Q8ZEG7|TRPD_YERPE | Anthranilate phosphoribosyltransferase OS=Yersinia pestis GN=trpD PE=3 SV=1 | 107 | 326 | 1.0E-30 |
sp|A7FI31|TRPD_YERP3 | Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=trpD PE=3 SV=1 | 107 | 326 | 1.0E-30 |
sp|A7NL64|TRPD_ROSCS | Anthranilate phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpD PE=3 SV=1 | 26 | 326 | 1.0E-30 |
sp|B0TWF2|TRPD_FRAP2 | Anthranilate phosphoribosyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=trpD PE=3 SV=1 | 12 | 326 | 1.0E-30 |
sp|Q4J8X7|TRPD_SULAC | Anthranilate phosphoribosyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trpD PE=3 SV=1 | 19 | 352 | 2.0E-30 |
sp|Q8PT97|TRPD_METMA | Anthranilate phosphoribosyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=trpD PE=3 SV=1 | 107 | 369 | 2.0E-30 |
sp|Q66AK2|TRPD_YERPS | Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=trpD PE=3 SV=1 | 107 | 326 | 2.0E-30 |
sp|A4TJ65|TRPD_YERPP | Anthranilate phosphoribosyltransferase OS=Yersinia pestis (strain Pestoides F) GN=trpD PE=3 SV=1 | 107 | 326 | 2.0E-30 |
sp|Q1CJ26|TRPD_YERPN | Anthranilate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=trpD PE=3 SV=1 | 107 | 326 | 2.0E-30 |
sp|B2K3W4|TRPD_YERPB | Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=trpD PE=3 SV=1 | 107 | 326 | 2.0E-30 |
sp|Q1C7P0|TRPD_YERPA | Anthranilate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=trpD PE=3 SV=1 | 107 | 326 | 2.0E-30 |
sp|Q8KC17|TRPD_CHLTE | Anthranilate phosphoribosyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trpD PE=3 SV=1 | 16 | 349 | 2.0E-30 |
sp|A6VU64|TRPD_MARMS | Anthranilate phosphoribosyltransferase OS=Marinomonas sp. (strain MWYL1) GN=trpD PE=3 SV=1 | 119 | 359 | 2.0E-30 |
sp|B1JKS0|TRPD_YERPY | Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=trpD PE=3 SV=1 | 107 | 326 | 2.0E-30 |
sp|A1RIE5|TRPD_SHESW | Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain W3-18-1) GN=trpD PE=3 SV=1 | 15 | 353 | 2.0E-30 |
sp|A1ALX3|TRPD_PELPD | Anthranilate phosphoribosyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=trpD PE=3 SV=1 | 27 | 406 | 2.0E-30 |
sp|Q28R66|TRPD_JANSC | Anthranilate phosphoribosyltransferase OS=Jannaschia sp. (strain CCS1) GN=trpD PE=3 SV=1 | 106 | 404 | 2.0E-30 |
sp|Q13TW5|TRPD_BURXL | Anthranilate phosphoribosyltransferase OS=Burkholderia xenovorans (strain LB400) GN=trpD PE=3 SV=2 | 58 | 300 | 2.0E-30 |
sp|Q12LE4|TRPD_SHEDO | Anthranilate phosphoribosyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=trpD PE=3 SV=1 | 40 | 353 | 2.0E-30 |
sp|O28668|TRPCD_ARCFU | Tryptophan biosynthesis protein TrpCD OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpCD PE=3 SV=1 | 105 | 320 | 2.0E-30 |
sp|Q5WY74|TRPD_LEGPL | Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Lens) GN=trpD PE=3 SV=1 | 67 | 343 | 2.0E-30 |
sp|Q63QH1|TRPD_BURPS | Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=trpD PE=3 SV=1 | 58 | 407 | 2.0E-30 |
sp|A3NDZ2|TRPD_BURP6 | Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 668) GN=trpD PE=3 SV=1 | 58 | 407 | 2.0E-30 |
sp|Q3JNB1|TRPD_BURP1 | Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=trpD PE=3 SV=1 | 58 | 407 | 2.0E-30 |
sp|A3NZP5|TRPD_BURP0 | Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=trpD PE=3 SV=1 | 58 | 407 | 2.0E-30 |
sp|A1UW99|TRPD_BURMS | Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain SAVP1) GN=trpD PE=3 SV=1 | 58 | 407 | 2.0E-30 |
sp|Q62DC9|TRPD_BURMA | Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=trpD PE=3 SV=1 | 58 | 407 | 2.0E-30 |
sp|A2RYI2|TRPD_BURM9 | Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=trpD PE=3 SV=1 | 58 | 407 | 2.0E-30 |
sp|A3MFQ3|TRPD_BURM7 | Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=trpD PE=3 SV=1 | 58 | 407 | 2.0E-30 |
sp|Q2G6R1|TRPD_NOVAD | Anthranilate phosphoribosyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=trpD PE=3 SV=1 | 109 | 393 | 2.0E-30 |
sp|A5UBZ6|TRPD_HAEIE | Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain PittEE) GN=trpD PE=3 SV=1 | 107 | 349 | 2.0E-30 |
sp|Q04ZD2|TRPD_LEPBL | Anthranilate phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=trpD PE=3 SV=1 | 39 | 321 | 3.0E-30 |
sp|Q04R23|TRPD_LEPBJ | Anthranilate phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=trpD PE=3 SV=1 | 39 | 321 | 3.0E-30 |
sp|A6TM73|TRPD_ALKMQ | Anthranilate phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=trpD PE=3 SV=2 | 108 | 407 | 3.0E-30 |
sp|Q21SE7|TRPD_RHOFT | Anthranilate phosphoribosyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=trpD PE=3 SV=1 | 107 | 407 | 3.0E-30 |
sp|Q8ECV2|TRPD_SHEON | Anthranilate phosphoribosyltransferase OS=Shewanella oneidensis (strain MR-1) GN=trpD PE=3 SV=1 | 14 | 353 | 4.0E-30 |
sp|B9MKD0|TRPD_CALBD | Anthranilate phosphoribosyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=trpD PE=3 SV=1 | 12 | 326 | 4.0E-30 |
sp|B1YSF6|TRPD_BURA4 | Anthranilate phosphoribosyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=trpD PE=3 SV=1 | 58 | 406 | 5.0E-30 |
sp|Q02000|TRPD_LACLA | Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpD PE=3 SV=1 | 25 | 329 | 5.0E-30 |
sp|Q18FI8|TRPD_HALWD | Anthranilate phosphoribosyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=trpD PE=3 SV=1 | 107 | 400 | 5.0E-30 |
sp|Q8ESU1|TRPD_OCEIH | Anthranilate phosphoribosyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpD PE=3 SV=1 | 27 | 348 | 5.0E-30 |
sp|B0SYZ3|TRPD_CAUSK | Anthranilate phosphoribosyltransferase OS=Caulobacter sp. (strain K31) GN=trpD PE=3 SV=1 | 107 | 348 | 5.0E-30 |
sp|Q0BIM7|TRPD_BURCM | Anthranilate phosphoribosyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=trpD PE=3 SV=1 | 58 | 406 | 6.0E-30 |
sp|Q0B006|TRPD_SYNWW | Anthranilate phosphoribosyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=trpD PE=3 SV=1 | 107 | 349 | 6.0E-30 |
sp|Q82AK1|TRPD_STRAW | Anthranilate phosphoribosyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpD PE=3 SV=1 | 26 | 405 | 6.0E-30 |
sp|P26924|TRPD_AZOBR | Anthranilate phosphoribosyltransferase OS=Azospirillum brasilense GN=trpD PE=3 SV=1 | 3 | 405 | 6.0E-30 |
sp|Q0A6E7|TRPD_ALKEH | Anthranilate phosphoribosyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=trpD PE=3 SV=1 | 21 | 407 | 6.0E-30 |
sp|A1TB00|TRPD_MYCVP | Anthranilate phosphoribosyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=trpD PE=3 SV=1 | 25 | 407 | 6.0E-30 |
sp|Q7VCJ6|TRPD_PROMA | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=trpD PE=3 SV=1 | 107 | 325 | 6.0E-30 |
sp|A5WFZ6|TRPD_PSYWF | Anthranilate phosphoribosyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=trpD PE=3 SV=1 | 52 | 405 | 7.0E-30 |
sp|Q0K6I1|TRPD_CUPNH | Anthranilate phosphoribosyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=trpD PE=3 SV=2 | 27 | 406 | 7.0E-30 |
sp|A3QF71|TRPD_SHELP | Anthranilate phosphoribosyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=trpD PE=3 SV=1 | 12 | 353 | 7.0E-30 |
sp|A9KTR5|TRPD_SHEB9 | Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS195) GN=trpD PE=3 SV=1 | 15 | 353 | 7.0E-30 |
sp|Q2SUI1|TRPD_BURTA | Anthranilate phosphoribosyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=trpD PE=3 SV=1 | 58 | 300 | 7.0E-30 |
sp|Q47AC6|TRPD_DECAR | Anthranilate phosphoribosyltransferase OS=Dechloromonas aromatica (strain RCB) GN=trpD PE=3 SV=1 | 103 | 406 | 8.0E-30 |
sp|Q0BTY4|TRPD_GRABC | Anthranilate phosphoribosyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=trpD PE=3 SV=1 | 1 | 349 | 8.0E-30 |
sp|A2SLH5|TRPD_METPP | Anthranilate phosphoribosyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=trpD PE=3 SV=1 | 107 | 407 | 8.0E-30 |
sp|Q2RIT6|TRPD_MOOTA | Anthranilate phosphoribosyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=trpD PE=3 SV=1 | 26 | 340 | 9.0E-30 |
sp|O27698|TRPD_METTH | Anthranilate phosphoribosyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpD PE=3 SV=1 | 45 | 409 | 9.0E-30 |
sp|B1I3Z8|TRPD_DESAP | Anthranilate phosphoribosyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=trpD PE=3 SV=1 | 15 | 325 | 1.0E-29 |
sp|A2RK17|TRPD_LACLM | Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=trpD PE=3 SV=1 | 26 | 324 | 1.0E-29 |
sp|A7H793|TRPD_ANADF | Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=trpD PE=3 SV=1 | 107 | 326 | 1.0E-29 |
sp|A2C1X5|TRPD_PROM1 | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=trpD PE=3 SV=1 | 107 | 357 | 2.0E-29 |
sp|P30525|TRPD_BACCA | Anthranilate phosphoribosyltransferase (Fragment) OS=Bacillus caldotenax GN=trpD PE=3 SV=1 | 15 | 277 | 2.0E-29 |
sp|C0ZCE2|TRPD_BREBN | Anthranilate phosphoribosyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=trpD PE=3 SV=1 | 106 | 370 | 2.0E-29 |
sp|C6DGZ7|TRPD_PECCP | Anthranilate phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=trpD PE=3 SV=1 | 92 | 326 | 2.0E-29 |
sp|Q7N488|TRPD_PHOLL | Anthranilate phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=trpD PE=3 SV=1 | 107 | 349 | 2.0E-29 |
sp|Q8FLJ8|TRPD_COREF | Anthranilate phosphoribosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=trpD PE=3 SV=1 | 69 | 325 | 2.0E-29 |
sp|A4XLM7|TRPD_CALS8 | Anthranilate phosphoribosyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=trpD PE=3 SV=1 | 108 | 329 | 3.0E-29 |
sp|Q3SGS1|TRPD_THIDA | Anthranilate phosphoribosyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=trpD PE=3 SV=1 | 107 | 401 | 3.0E-29 |
sp|Q02YA8|TRPD_LACLS | Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=trpD PE=3 SV=1 | 26 | 324 | 3.0E-29 |
sp|Q46L78|TRPD_PROMT | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=trpD PE=3 SV=1 | 107 | 357 | 3.0E-29 |
sp|A1TJQ1|TRPD_ACIAC | Anthranilate phosphoribosyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=trpD PE=3 SV=1 | 107 | 409 | 3.0E-29 |
sp|Q5P2G2|TRPD_AROAE | Anthranilate phosphoribosyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=trpD PE=3 SV=1 | 107 | 401 | 3.0E-29 |
sp|Q12TL1|TRPD_METBU | Anthranilate phosphoribosyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=trpD PE=3 SV=1 | 15 | 351 | 3.0E-29 |
sp|B2VKT4|TRPD_ERWT9 | Anthranilate phosphoribosyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=trpD PE=3 SV=1 | 41 | 349 | 3.0E-29 |
sp|A3D628|TRPD_SHEB5 | Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=trpD PE=3 SV=1 | 15 | 353 | 4.0E-29 |
sp|A1WH74|TRPD_VEREI | Anthranilate phosphoribosyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=trpD PE=3 SV=2 | 107 | 353 | 4.0E-29 |
sp|B2UDK8|TRPD_RALPJ | Anthranilate phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=trpD PE=3 SV=1 | 58 | 406 | 4.0E-29 |
sp|P00500|TRPD_ACIAD | Anthranilate phosphoribosyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpD PE=1 SV=1 | 47 | 351 | 4.0E-29 |
sp|C1AU95|TRPD_RHOOB | Anthranilate phosphoribosyltransferase OS=Rhodococcus opacus (strain B4) GN=trpD PE=3 SV=1 | 18 | 340 | 5.0E-29 |
sp|A0Q8R1|TRPD_FRATN | Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=trpD PE=3 SV=1 | 12 | 326 | 6.0E-29 |
sp|B5ERI3|TRPD_ACIF5 | Anthranilate phosphoribosyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=trpD PE=3 SV=1 | 26 | 307 | 6.0E-29 |
sp|B7JBC1|TRPD_ACIF2 | Anthranilate phosphoribosyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=trpD PE=3 SV=1 | 26 | 307 | 6.0E-29 |
sp|Q5WGS4|TRPD_BACSK | Anthranilate phosphoribosyltransferase OS=Bacillus clausii (strain KSM-K16) GN=trpD PE=3 SV=1 | 106 | 349 | 8.0E-29 |
sp|B2HGW0|TRPD_MYCMM | Anthranilate phosphoribosyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=trpD PE=3 SV=1 | 17 | 407 | 9.0E-29 |
sp|A6WPW9|TRPD_SHEB8 | Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS185) GN=trpD PE=3 SV=1 | 15 | 353 | 1.0E-28 |
sp|P52562|TRPD_HALVD | Anthranilate phosphoribosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpD PE=3 SV=2 | 105 | 400 | 1.0E-28 |
sp|A0PTM6|TRPD_MYCUA | Anthranilate phosphoribosyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=trpD PE=3 SV=1 | 17 | 407 | 1.0E-28 |
sp|Q72PD0|TRPD_LEPIC | Anthranilate phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=trpD PE=3 SV=1 | 27 | 401 | 1.0E-28 |
sp|Q11PY2|TRPD_CYTH3 | Anthranilate phosphoribosyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=trpD PE=3 SV=1 | 67 | 326 | 1.0E-28 |
sp|C3MV89|TRPD_SULIM | Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=trpD PE=3 SV=1 | 108 | 345 | 1.0E-28 |
sp|C4KH54|TRPD_SULIK | Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=trpD PE=3 SV=1 | 108 | 345 | 1.0E-28 |
sp|P20574|TRPD_PSEAE | Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpD PE=3 SV=1 | 13 | 303 | 1.0E-28 |
sp|Q02TB6|TRPD_PSEAB | Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=trpD PE=3 SV=1 | 13 | 303 | 1.0E-28 |
sp|B7V608|TRPD_PSEA8 | Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=trpD PE=3 SV=1 | 13 | 303 | 1.0E-28 |
sp|Q8YZP8|TRPD1_NOSS1 | Anthranilate phosphoribosyltransferase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpD1 PE=3 SV=1 | 99 | 354 | 1.0E-28 |
sp|C3NE52|TRPD_SULIY | Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=trpD PE=3 SV=1 | 108 | 345 | 1.0E-28 |
sp|C3MPW2|TRPD_SULIL | Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=trpD PE=3 SV=1 | 108 | 345 | 1.0E-28 |
sp|C3NHL1|TRPD_SULIN | Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=trpD PE=3 SV=1 | 108 | 345 | 1.0E-28 |
sp|Q3M4T0|TRPD_ANAVT | Anthranilate phosphoribosyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=trpD PE=3 SV=1 | 1 | 326 | 2.0E-28 |
sp|Q0VMX5|TRPD_ALCBS | Anthranilate phosphoribosyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=trpD PE=3 SV=1 | 28 | 379 | 2.0E-28 |
sp|Q8F708|TRPD_LEPIN | Anthranilate phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=trpD PE=3 SV=1 | 42 | 401 | 2.0E-28 |
sp|Q9Y8T2|TRPD_AERPE | Anthranilate phosphoribosyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpD PE=3 SV=1 | 103 | 325 | 2.0E-28 |
sp|Q2NT50|TRPD_SODGM | Anthranilate phosphoribosyltransferase OS=Sodalis glossinidius (strain morsitans) GN=trpD PE=3 SV=1 | 107 | 326 | 2.0E-28 |
sp|A6UZF1|TRPD_PSEA7 | Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=trpD PE=3 SV=1 | 13 | 303 | 2.0E-28 |
sp|A2BWT1|TRPD_PROM5 | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=trpD PE=3 SV=1 | 107 | 350 | 2.0E-28 |
sp|Q8XVE7|TRPD1_RALSO | Anthranilate phosphoribosyltransferase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=trpD1 PE=3 SV=1 | 107 | 406 | 3.0E-28 |
sp|Q0SHN1|TRPD_RHOJR | Anthranilate phosphoribosyltransferase OS=Rhodococcus jostii (strain RHA1) GN=trpD PE=3 SV=1 | 21 | 340 | 3.0E-28 |
sp|Q1IZP8|TRPD_DEIGD | Anthranilate phosphoribosyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=trpD PE=3 SV=1 | 107 | 345 | 3.0E-28 |
sp|Q8YXQ9|TRPD2_NOSS1 | Anthranilate phosphoribosyltransferase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpD2 PE=1 SV=1 | 1 | 326 | 3.0E-28 |
sp|Q971Z7|TRPD_SULTO | Anthranilate phosphoribosyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpD PE=3 SV=1 | 108 | 345 | 3.0E-28 |
sp|P50384|TRPD_SULSO | Anthranilate phosphoribosyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpD PE=1 SV=1 | 108 | 345 | 3.0E-28 |
sp|Q30VM1|TRPD_DESAG | Anthranilate phosphoribosyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=trpD PE=3 SV=1 | 25 | 340 | 3.0E-28 |
sp|P57367|TRPD_BUCAI | Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpD PE=3 SV=1 | 46 | 396 | 3.0E-28 |
sp|B8D972|TRPD_BUCA5 | Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=trpD PE=3 SV=1 | 46 | 396 | 3.0E-28 |
sp|C3N5I8|TRPD_SULIA | Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=trpD PE=3 SV=1 | 108 | 345 | 4.0E-28 |
sp|B8D7H6|TRPD_BUCAT | Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=trpD PE=3 SV=1 | 46 | 396 | 4.0E-28 |
sp|O68426|TRPD_BUCDN | Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpD PE=3 SV=1 | 107 | 389 | 4.0E-28 |
sp|Q0BJW6|TRPD_FRATO | Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=trpD PE=3 SV=2 | 12 | 326 | 4.0E-28 |
sp|A7NF00|TRPD_FRATF | Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=trpD PE=3 SV=2 | 12 | 326 | 5.0E-28 |
sp|Q2FKX5|TRPD_METHJ | Anthranilate phosphoribosyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=trpD PE=3 SV=1 | 27 | 395 | 5.0E-28 |
sp|Q5LRH8|TRPD_RUEPO | Anthranilate phosphoribosyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=trpD PE=3 SV=1 | 106 | 325 | 5.0E-28 |
sp|Q7NW17|TRPD_CHRVO | Anthranilate phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=trpD PE=3 SV=1 | 26 | 408 | 6.0E-28 |
sp|B2SEF6|TRPD_FRATM | Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=trpD PE=3 SV=1 | 12 | 326 | 6.0E-28 |
sp|A2STA7|TRPD_METLZ | Anthranilate phosphoribosyltransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=trpD PE=3 SV=1 | 28 | 347 | 6.0E-28 |
sp|B5YD05|TRPD_DICT6 | Anthranilate phosphoribosyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=trpD PE=3 SV=1 | 108 | 349 | 6.0E-28 |
sp|A4J0E5|TRPD_FRATW | Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=trpD PE=3 SV=2 | 12 | 326 | 1.0E-27 |
sp|B8DZP4|TRPD_DICTD | Anthranilate phosphoribosyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=trpD PE=3 SV=1 | 108 | 349 | 2.0E-27 |
sp|Q822W6|TRPD_CHLCV | Anthranilate phosphoribosyltransferase OS=Chlamydophila caviae (strain GPIC) GN=trpD PE=3 SV=1 | 68 | 400 | 2.0E-27 |
sp|Q2S999|TRPD_HAHCH | Anthranilate phosphoribosyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=trpD PE=3 SV=1 | 13 | 298 | 2.0E-27 |
sp|B1Y7I3|TRPD_LEPCP | Anthranilate phosphoribosyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=trpD PE=3 SV=1 | 107 | 405 | 3.0E-27 |
sp|Q9RQ35|TRPD_BUCMH | Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Melaphis rhois GN=trpD PE=3 SV=1 | 18 | 349 | 4.0E-27 |
sp|Q7TU90|TRPD_PROMP | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpD PE=3 SV=1 | 26 | 350 | 4.0E-27 |
sp|Q2W3A9|TRPD_MAGSA | Anthranilate phosphoribosyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=trpD PE=3 SV=1 | 106 | 329 | 5.0E-27 |
sp|A6SUH6|TRPD_JANMA | Anthranilate phosphoribosyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=trpD PE=3 SV=1 | 107 | 353 | 5.0E-27 |
sp|Q2S1Z6|TRPD_SALRD | Anthranilate phosphoribosyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=trpD PE=3 SV=1 | 109 | 348 | 5.0E-27 |
sp|Q4L676|TRPD_STAHJ | Anthranilate phosphoribosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trpD PE=3 SV=1 | 103 | 359 | 6.0E-27 |
sp|Q31J09|TRPD_THICR | Anthranilate phosphoribosyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=trpD PE=3 SV=1 | 15 | 405 | 7.0E-27 |
sp|B8GJ30|TRPD_METPE | Anthranilate phosphoribosyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=trpD PE=3 SV=1 | 15 | 349 | 8.0E-27 |
sp|A1SLE8|TRPD_NOCSJ | Anthranilate phosphoribosyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=trpD PE=3 SV=1 | 23 | 404 | 8.0E-27 |
sp|B9LQ96|TRPD_HALLT | Anthranilate phosphoribosyltransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=trpD PE=3 SV=1 | 26 | 400 | 1.0E-26 |
sp|P26925|TRPD_METTM | Anthranilate phosphoribosyltransferase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpD PE=3 SV=1 | 27 | 407 | 1.0E-26 |
sp|B8DM45|TRPD_DESVM | Anthranilate phosphoribosyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=trpD PE=3 SV=1 | 105 | 345 | 1.0E-26 |
sp|P66998|TRPD_STAAW | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=trpD PE=3 SV=1 | 103 | 400 | 1.0E-26 |
sp|Q6G9J0|TRPD_STAAS | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=trpD PE=3 SV=1 | 103 | 400 | 1.0E-26 |
sp|P66997|TRPD_STAAN | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=trpD PE=3 SV=1 | 103 | 400 | 1.0E-26 |
sp|P66996|TRPD_STAAM | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trpD PE=3 SV=1 | 103 | 400 | 1.0E-26 |
sp|A5ISQ1|TRPD_STAA9 | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain JH9) GN=trpD PE=3 SV=1 | 103 | 400 | 1.0E-26 |
sp|A6U1J1|TRPD_STAA2 | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain JH1) GN=trpD PE=3 SV=1 | 103 | 400 | 1.0E-26 |
sp|A7X232|TRPD_STAA1 | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=trpD PE=3 SV=1 | 103 | 400 | 1.0E-26 |
sp|Q31LB6|TRPD_SYNE7 | Anthranilate phosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=trpD PE=3 SV=1 | 107 | 326 | 1.0E-26 |
sp|P42392|TRPD_BUCAP | Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpD PE=3 SV=1 | 46 | 349 | 2.0E-26 |
sp|Q49XH5|TRPD_STAS1 | Anthranilate phosphoribosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trpD PE=3 SV=1 | 98 | 325 | 2.0E-26 |
sp|A5FA70|TRPD_FLAJ1 | Anthranilate phosphoribosyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=trpD PE=3 SV=1 | 67 | 326 | 3.0E-26 |
sp|A6QGS1|TRPD_STAAE | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain Newman) GN=trpD PE=3 SV=1 | 103 | 397 | 3.0E-26 |
sp|Q9RL77|TRPD_STAAC | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=trpD PE=3 SV=2 | 103 | 397 | 3.0E-26 |
sp|Q2FYR7|TRPD_STAA8 | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=trpD PE=3 SV=1 | 103 | 397 | 3.0E-26 |
sp|Q2FH67|TRPD_STAA3 | Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300) GN=trpD PE=3 SV=1 | 103 | 397 | 3.0E-26 |
sp|Q6AFI7|TRPD_LEIXX | Anthranilate phosphoribosyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=trpD PE=3 SV=1 | 108 | 404 | 4.0E-26 |
sp|Q5N0L1|TRPD_SYNP6 | Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=trpD PE=3 SV=1 | 107 | 326 | 4.0E-26 |
sp|Q2NA97|TRPD_ERYLH | Anthranilate phosphoribosyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=trpD PE=3 SV=1 | 46 | 340 | 7.0E-26 |
sp|P83827|TRPD_THETH | Anthranilate phosphoribosyltransferase OS=Thermus thermophilus GN=trpD PE=1 SV=1 | 107 | 401 | 9.0E-26 |
sp|Q5SH88|TRPD_THET8 | Anthranilate phosphoribosyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpD PE=1 SV=1 | 107 | 401 | 9.0E-26 |
sp|Q72HJ6|TRPD_THET2 | Anthranilate phosphoribosyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=trpD PE=3 SV=1 | 107 | 401 | 9.0E-26 |
sp|A4FAC5|TRPD_SACEN | Anthranilate phosphoribosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=trpD PE=3 SV=1 | 26 | 326 | 1.0E-25 |
sp|Q4K502|TRPD_PSEF5 | Anthranilate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=trpD PE=3 SV=1 | 13 | 303 | 1.0E-25 |
sp|A0JX18|TRPD_ARTS2 | Anthranilate phosphoribosyltransferase OS=Arthrobacter sp. (strain FB24) GN=trpD PE=3 SV=1 | 17 | 405 | 1.0E-25 |
sp|Q7NGU2|TRPD_GLOVI | Anthranilate phosphoribosyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=trpD PE=3 SV=1 | 107 | 326 | 1.0E-25 |
sp|B4UHD1|TRPD_ANASK | Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter sp. (strain K) GN=trpD PE=3 SV=1 | 15 | 326 | 2.0E-25 |
sp|A4G1P5|TRPD_HERAR | Anthranilate phosphoribosyltransferase OS=Herminiimonas arsenicoxydans GN=trpD PE=3 SV=1 | 107 | 410 | 2.0E-25 |
sp|A8G4M3|TRPD_PROM2 | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=trpD PE=3 SV=1 | 99 | 350 | 2.0E-25 |
sp|A3Q1Q2|TRPD_MYCSJ | Anthranilate phosphoribosyltransferase OS=Mycobacterium sp. (strain JLS) GN=trpD PE=3 SV=1 | 20 | 407 | 2.0E-25 |
sp|Q1B6T7|TRPD_MYCSS | Anthranilate phosphoribosyltransferase OS=Mycobacterium sp. (strain MCS) GN=trpD PE=3 SV=1 | 20 | 407 | 2.0E-25 |
sp|A1UI88|TRPD_MYCSK | Anthranilate phosphoribosyltransferase OS=Mycobacterium sp. (strain KMS) GN=trpD PE=3 SV=1 | 20 | 407 | 2.0E-25 |
sp|Q1CZH6|TRPD_MYXXD | Anthranilate phosphoribosyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=trpD PE=3 SV=1 | 107 | 326 | 3.0E-25 |
sp|A3PCQ4|TRPD_PROM0 | Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=trpD PE=3 SV=1 | 99 | 350 | 3.0E-25 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016757 | glycosyltransferase activity | Yes |
GO:0003674 | molecular_function | No |
GO:0016740 | transferase activity | No |
GO:0003824 | catalytic activity | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 21 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|4801 MTTSPNENSAAMVDIKPLLTKLWPTGRDVPADEIANAISHFFTNSVTEAQAASLLVALHFTAMDMRSDVLARCAL VMLRAVSRGSVRDLEAALARRARPEGRYGGGLCDIVGTGGDSHDTFNVSTTSSILASALLLVSKHGNKASTSKSG SADMVACMKPRAPIMDAVRPDTMARVYSATNYGFIFAPLFHTGMRFVSPIRRQLPWRTIFNNVGPLANPLHELVE ARVIGIGRRDLGTPFCEALRTLGCRKALIVCGDEELDEISCAGPTSCWALWETSPGGDVLPDHFKIEPRDFGLEC HPLSEVSSGKNPEDNAAILTRILQGELAADDPLLDFIMMNTAALLVVSGICEADTSAMGPGDDGKVVMERGPGGQ RWKEGVRRARWAMESGEARRQWEAFVDVTHEIGSK* |
Coding | >Ophun1|4801 ATGACGACATCCCCAAATGAGAATAGCGCGGCCATGGTCGACATCAAGCCATTGTTGACCAAGCTCTGGCCGACG GGAAGAGATGTTCCGGCAGACGAAATCGCCAATGCCATATCTCATTTCTTCACCAACAGCGTCACCGAGGCCCAG GCGGCGTCGCTGTTGGTGGCGCTCCATTTCACCGCCATGGACATGCGCTCCGACGTCCTGGCTCGCTGTGCCCTC GTCATGCTGCGAGCCGTATCGCGAGGCTCCGTCCGTGACCTCGAGGCGGCGCTGGCTCGCCGTGCCAGGCCCGAG GGCAGATACGGGGGCGGGCTGTGTGATATTGTCGGCACCGGGGGCGACTCGCACGATACCTTCAACGTCAGCACC ACGTCGTCCATCCTCGCCTCGGCCCTGCTCCTCGTGTCCAAGCACGGCAACAAGGCCAGCACGTCCAAGTCGGGC AGCGCTGACATGGTCGCCTGTATGAAGCCGCGAGCCCCCATCATGGACGCCGTCCGGCCGGATACTATGGCCCGG GTCTACTCGGCCACCAACTACGGCTTCATCTTCGCCCCGCTCTTCCATACCGGCATGCGCTTCGTCTCCCCCATC CGCCGCCAGCTGCCGTGGCGCACCATCTTCAACAATGTCGGGCCGCTGGCCAACCCGCTTCACGAGCTCGTCGAG GCCCGCGTCATAGGTATCGGCAGGCGAGATCTCGGCACGCCCTTTTGCGAGGCGCTACGCACTCTCGGCTGTCGC AAGGCCCTCATCGTCTGCGGCGACGAGGAGCTCGACGAGATCAGCTGCGCCGGCCCGACCAGCTGCTGGGCGCTG TGGGAGACGTCTCCCGGGGGCGACGTGTTACCGGACCATTTCAAGATTGAGCCGCGCGACTTTGGGCTGGAGTGT CATCCGCTGAGCGAGGTGTCGTCGGGCAAGAACCCAGAGGACAACGCGGCCATCCTGACGCGCATTCTACAGGGA GAGCTGGCTGCCGACGACCCGCTGCTGGACTTTATCATGATGAACACGGCGGCGCTGCTGGTAGTATCCGGCATC TGCGAGGCCGACACCAGCGCCATGGGGCCCGGAGACGACGGCAAGGTGGTGATGGAGCGCGGGCCGGGCGGGCAG CGGTGGAAGGAGGGCGTGAGGAGGGCCAGATGGGCCATGGAGAGCGGCGAGGCCAGGAGGCAGTGGGAAGCGTTT GTCGATGTGACGCACGAGATTGGCAGCAAGTGA |
Transcript | >Ophun1|4801 ATGACGACATCCCCAAATGAGAATAGCGCGGCCATGGTCGACATCAAGCCATTGTTGACCAAGCTCTGGCCGACG GGAAGAGATGTTCCGGCAGACGAAATCGCCAATGCCATATCTCATTTCTTCACCAACAGCGTCACCGAGGCCCAG GCGGCGTCGCTGTTGGTGGCGCTCCATTTCACCGCCATGGACATGCGCTCCGACGTCCTGGCTCGCTGTGCCCTC GTCATGCTGCGAGCCGTATCGCGAGGCTCCGTCCGTGACCTCGAGGCGGCGCTGGCTCGCCGTGCCAGGCCCGAG GGCAGATACGGGGGCGGGCTGTGTGATATTGTCGGCACCGGGGGCGACTCGCACGATACCTTCAACGTCAGCACC ACGTCGTCCATCCTCGCCTCGGCCCTGCTCCTCGTGTCCAAGCACGGCAACAAGGCCAGCACGTCCAAGTCGGGC AGCGCTGACATGGTCGCCTGTATGAAGCCGCGAGCCCCCATCATGGACGCCGTCCGGCCGGATACTATGGCCCGG GTCTACTCGGCCACCAACTACGGCTTCATCTTCGCCCCGCTCTTCCATACCGGCATGCGCTTCGTCTCCCCCATC CGCCGCCAGCTGCCGTGGCGCACCATCTTCAACAATGTCGGGCCGCTGGCCAACCCGCTTCACGAGCTCGTCGAG GCCCGCGTCATAGGTATCGGCAGGCGAGATCTCGGCACGCCCTTTTGCGAGGCGCTACGCACTCTCGGCTGTCGC AAGGCCCTCATCGTCTGCGGCGACGAGGAGCTCGACGAGATCAGCTGCGCCGGCCCGACCAGCTGCTGGGCGCTG TGGGAGACGTCTCCCGGGGGCGACGTGTTACCGGACCATTTCAAGATTGAGCCGCGCGACTTTGGGCTGGAGTGT CATCCGCTGAGCGAGGTGTCGTCGGGCAAGAACCCAGAGGACAACGCGGCCATCCTGACGCGCATTCTACAGGGA GAGCTGGCTGCCGACGACCCGCTGCTGGACTTTATCATGATGAACACGGCGGCGCTGCTGGTAGTATCCGGCATC TGCGAGGCCGACACCAGCGCCATGGGGCCCGGAGACGACGGCAAGGTGGTGATGGAGCGCGGGCCGGGCGGGCAG CGGTGGAAGGAGGGCGTGAGGAGGGCCAGATGGGCCATGGAGAGCGGCGAGGCCAGGAGGCAGTGGGAAGCGTTT GTCGATGTGACGCACGAGATTGGCAGCAAGTGA |
Gene | >Ophun1|4801 ATGACGACATCCCCAAATGAGAATAGCGCGGCCATGGTCGACATCAAGCCATTGTTGACCAAGCTCTGGCCGACG GGAAGAGATGTTCCGGCAGACGAAATCGCCAATGCCATATCTCATTTCTTCACCAACAGCGTCACCGAGGCCCAG GCGGCGTCGCTGTTGGTGGCGCTCCATTTCACCGCCATGGACATGCGCTCCGACGTCCTGGCTCGCTGTGCCCTC GTCATGCTGCGAGCCGTATCGCGAGGCTCCGTCCGTGACCTCGAGGCGGCGCTGGCTCGCCGTGCCAGGCCCGAG GGCAGATACGGGGGCGGGCTGGTAAGATCCCTCGTCGGGCCCGGCCGCGTCGACTGACGGCTTGGAACAACGGGC AGTGTGATATTGTCGGCACCGGGGGCGACTCGCACGATACCTTCAACGTCAGCACCACGTCGTCCATCCTCGCCT CGGCCCTGCTCCTCGTGTCCAAGCACGGCAACAAGGCCAGCACGTCCAAGTCGGGCAGCGCTGACATGGTCGCCT GTATGAAGCCGCGAGCCCCCATCATGGACGCCGTCCGGCCGGATACTATGGCCCGGGTCTACTCGGCCACCAACT ACGGCTTCATCTTCGCCCCGCTCTTCCATACCGGCATGCGCTTCGTCTCCCCCATCCGCCGCCAGCTGCCGTGGC GCACCATCTTCAACAATGTCGGGCCGCTGGCCAACCCGCTTCACGAGCTCGTCGAGGCCCGCGTCATAGGTATCG GCAGGCGAGATCTCGGCACGCCCTTTTGCGAGGCGCTACGCACTCTCGGCTGTCGCAAGGCCCTCATCGTCTGCG GCGACGAGGAGCTCGACGAGATCAGCTGCGCCGGCCCGACCAGCTGCTGGGCGCTGTGGGAGACGTCTCCCGGGG GCGACGTGTTACCGGACCATTTCAAGATTGAGCCGCGCGACTTTGGGCTGGAGTGTCATCCGCTGAGCGAGGTGT CGTCGGGCAAGAACCCAGAGGACAACGCGGCCATCCTGACGCGCATTCTACAGGGAGAGCTGGCTGCCGACGACC CGCTGCTGGACTTTATCATGATGAACACGGCGGCGCTGCTGGTAGTATCCGGCATCTGCGAGGCCGACACCAGCG CCATGGGGCCCGGAGACGACGGCAAGGTGGTGATGGAGCGCGGGCCGGGCGGGCAGCGGTGGAAGGAGGGCGTGA GGAGGGCCAGATGGGCCATGGAGAGCGGCGAGGCCAGGAGGCAGTGGGAAGCGTTTGTCGATGTGACGCACGAGA TTGGCAGCAAGTGA |