Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4799
Gene name
LocationContig_450:3394..4720
Strand+
Gene length (bp)1326
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.6E-22 112 363
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.4E-07 112 357
PF12146 Hydrolase_4 Serine aminopeptidase, S33 6.9E-07 113 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IQC1|PPME1_GIBZE Protein phosphatase methylesterase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPE1 PE=3 SV=1 1 394 0.0E+00
sp|Q7SGG8|PPME1_NEUCR Protein phosphatase methylesterase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pme-1 PE=3 SV=1 1 394 3.0E-171
sp|Q2URJ0|PPME1_ASPOR Protein phosphatase methylesterase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ppe1 PE=3 SV=2 1 391 5.0E-155
sp|Q5BGN7|PPME1_EMENI Protein phosphatase methylesterase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppe1 PE=3 SV=2 1 387 3.0E-152
sp|Q4WKB2|PPME1_ASPFU Protein phosphatase methylesterase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppe1 PE=3 SV=1 1 387 2.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IQC1|PPME1_GIBZE Protein phosphatase methylesterase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPE1 PE=3 SV=1 1 394 0.0E+00
sp|Q7SGG8|PPME1_NEUCR Protein phosphatase methylesterase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pme-1 PE=3 SV=1 1 394 3.0E-171
sp|Q2URJ0|PPME1_ASPOR Protein phosphatase methylesterase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ppe1 PE=3 SV=2 1 391 5.0E-155
sp|Q5BGN7|PPME1_EMENI Protein phosphatase methylesterase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppe1 PE=3 SV=2 1 387 3.0E-152
sp|Q4WKB2|PPME1_ASPFU Protein phosphatase methylesterase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppe1 PE=3 SV=1 1 387 2.0E-147
sp|Q9P7D2|PPME1_SCHPO Protein phosphatase methylesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=3 SV=1 78 384 3.0E-81
sp|Q6CGE1|PPME1_YARLI Protein phosphatase methylesterase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPE1 PE=3 SV=1 41 381 2.0E-75
sp|P0CO62|PPME1_CRYNJ Protein phosphatase methylesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPE1 PE=3 SV=1 75 384 4.0E-71
sp|P0CO63|PPME1_CRYNB Protein phosphatase methylesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PPE1 PE=3 SV=1 75 384 4.0E-71
sp|Q74Z47|PPME1_ASHGO Protein phosphatase methylesterase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPE1 PE=3 SV=1 2 380 4.0E-65
sp|Q58DN4|PPME1_BOVIN Protein phosphatase methylesterase 1 OS=Bos taurus GN=PPME1 PE=2 SV=3 66 373 2.0E-61
sp|Q8BVQ5|PPME1_MOUSE Protein phosphatase methylesterase 1 OS=Mus musculus GN=Ppme1 PE=1 SV=5 66 373 6.0E-61
sp|Q9Y570|PPME1_HUMAN Protein phosphatase methylesterase 1 OS=Homo sapiens GN=PPME1 PE=1 SV=3 66 373 1.0E-60
sp|Q4FZT2|PPME1_RAT Protein phosphatase methylesterase 1 OS=Rattus norvegicus GN=Ppme1 PE=1 SV=2 66 373 3.0E-60
sp|Q6BZG3|PPME1_DEBHA Protein phosphatase methylesterase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPE1 PE=3 SV=2 95 374 6.0E-60
sp|Q5R4F9|PPME1_PONAB Protein phosphatase methylesterase 1 OS=Pongo abelii GN=PPME1 PE=2 SV=3 66 373 2.0E-59
sp|Q6FNL6|PPME1_CANGA Protein phosphatase methylesterase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPE1 PE=3 SV=1 75 380 1.0E-57
sp|Q9BIB3|PPME1_CAEEL Probable protein phosphatase methylesterase 1 OS=Caenorhabditis elegans GN=B0464.9 PE=3 SV=1 69 382 5.0E-56
sp|P38796|PPME1_YEAST Protein phosphatase methylesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPE1 PE=1 SV=1 78 380 4.0E-55
sp|Q6CQZ5|PPME1_KLULA Protein phosphatase methylesterase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPE1 PE=3 SV=1 78 380 5.0E-54
sp|Q5ALW7|PPME1_CANAL Protein phosphatase methylesterase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPE1 PE=3 SV=1 98 372 2.0E-52
sp|Q54TN3|PPME1_DICDI Probable protein phosphatase methylesterase 1 OS=Dictyostelium discoideum GN=ppme1 PE=3 SV=1 76 360 1.0E-49
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4799
MSHLQRAWARSKLGLANGSLEEDDQEGSMASEEHAADDDSSSASSVSSTGTIIPAPSQRLFARPEGVARGRALDP
IPWTTYFERELFLSPPAEPAVTFHAYLSSPVDKGVLFVMHHGAGSSGLTFAVVGAEIRKSLPSAGILAVDCRGHG
STVSPEGQALDLRLQTLSSDLFTVIQMTKDQMGWKQLPNIILVGHSLGGAVVTDLAMTGELGNSLLGYVVLDVVE
GSAMDALQSMHTYLSSRPTGFASLQAAIDWHIRSRTVRNSISARTSVGPLLRLDEGADPSRPWVWRTNLSATQPF
WEGWFVGLSSKFLRAKGGKLLLLAGTDRLDTELTIGQMQGKYALQVFPEAGHFIQEDIPTQTATSLVDFYRRNDR
SALVLPPKVSDLLKQGKAV*
Coding >Ophun1|4799
ATGAGCCATTTGCAGCGGGCTTGGGCTCGTTCCAAGCTCGGACTCGCGAATGGCTCCCTCGAAGAAGATGACCAA
GAAGGAAGCATGGCCTCGGAAGAGCACGCTGCTGATGACGACTCCTCGTCGGCCTCGTCGGTTTCGTCCACGGGC
ACCATCATTCCAGCGCCCAGCCAGCGGCTCTTCGCCCGTCCCGAGGGAGTCGCTCGCGGCCGAGCTCTGGACCCC
ATTCCCTGGACAACCTACTTCGAGCGCGAACTGTTCCTCTCCCCTCCCGCCGAGCCGGCCGTCACCTTTCACGCC
TATCTCAGCTCGCCCGTCGACAAGGGCGTGCTTTTCGTCATGCATCACGGCGCCGGATCCTCCGGCCTCACCTTC
GCCGTCGTCGGCGCCGAGATTCGCAAAAGCCTGCCCTCGGCCGGTATCCTTGCCGTCGACTGCAGGGGTCACGGT
TCCACCGTCTCGCCAGAGGGCCAGGCTCTTGATCTCCGGCTGCAGACGCTTTCGTCCGATCTCTTCACCGTCATT
CAAATGACAAAGGACCAGATGGGATGGAAACAATTGCCCAACATCATCCTCGTCGGACACTCTCTTGGCGGCGCC
GTCGTCACCGACCTGGCCATGACCGGCGAGCTTGGCAACTCCCTGCTGGGCTATGTCGTCCTCGACGTCGTCGAA
GGTTCCGCCATGGACGCACTGCAGAGCATGCACACCTACCTCTCGTCCAGGCCAACAGGCTTCGCCTCGCTGCAG
GCCGCCATCGACTGGCACATCCGCTCGAGGACCGTGCGCAACTCCATCTCGGCCAGGACCTCGGTCGGCCCCCTC
CTCAGGCTGGACGAAGGCGCTGATCCCTCCCGGCCCTGGGTTTGGAGGACGAATCTTTCGGCCACGCAGCCCTTC
TGGGAGGGCTGGTTCGTCGGTCTCAGCAGCAAGTTCTTGCGGGCCAAGGGCGGCAAGCTGCTCCTCCTGGCTGGC
ACCGATCGGCTCGATACCGAGCTGACAATTGGTCAGATGCAGGGCAAATATGCGCTGCAAGTGTTTCCGGAAGCC
GGTCACTTCATCCAGGAGGACATCCCCACCCAGACGGCCACCTCGCTCGTCGACTTTTACCGAAGAAACGACCGC
AGCGCACTGGTGTTGCCGCCCAAGGTATCAGACCTCTTGAAGCAGGGCAAGGCCGTGTGA
Transcript >Ophun1|4799
ATGAGCCATTTGCAGCGGGCTTGGGCTCGTTCCAAGCTCGGACTCGCGAATGGCTCCCTCGAAGAAGATGACCAA
GAAGGAAGCATGGCCTCGGAAGAGCACGCTGCTGATGACGACTCCTCGTCGGCCTCGTCGGTTTCGTCCACGGGC
ACCATCATTCCAGCGCCCAGCCAGCGGCTCTTCGCCCGTCCCGAGGGAGTCGCTCGCGGCCGAGCTCTGGACCCC
ATTCCCTGGACAACCTACTTCGAGCGCGAACTGTTCCTCTCCCCTCCCGCCGAGCCGGCCGTCACCTTTCACGCC
TATCTCAGCTCGCCCGTCGACAAGGGCGTGCTTTTCGTCATGCATCACGGCGCCGGATCCTCCGGCCTCACCTTC
GCCGTCGTCGGCGCCGAGATTCGCAAAAGCCTGCCCTCGGCCGGTATCCTTGCCGTCGACTGCAGGGGTCACGGT
TCCACCGTCTCGCCAGAGGGCCAGGCTCTTGATCTCCGGCTGCAGACGCTTTCGTCCGATCTCTTCACCGTCATT
CAAATGACAAAGGACCAGATGGGATGGAAACAATTGCCCAACATCATCCTCGTCGGACACTCTCTTGGCGGCGCC
GTCGTCACCGACCTGGCCATGACCGGCGAGCTTGGCAACTCCCTGCTGGGCTATGTCGTCCTCGACGTCGTCGAA
GGTTCCGCCATGGACGCACTGCAGAGCATGCACACCTACCTCTCGTCCAGGCCAACAGGCTTCGCCTCGCTGCAG
GCCGCCATCGACTGGCACATCCGCTCGAGGACCGTGCGCAACTCCATCTCGGCCAGGACCTCGGTCGGCCCCCTC
CTCAGGCTGGACGAAGGCGCTGATCCCTCCCGGCCCTGGGTTTGGAGGACGAATCTTTCGGCCACGCAGCCCTTC
TGGGAGGGCTGGTTCGTCGGTCTCAGCAGCAAGTTCTTGCGGGCCAAGGGCGGCAAGCTGCTCCTCCTGGCTGGC
ACCGATCGGCTCGATACCGAGCTGACAATTGGTCAGATGCAGGGCAAATATGCGCTGCAAGTGTTTCCGGAAGCC
GGTCACTTCATCCAGGAGGACATCCCCACCCAGACGGCCACCTCGCTCGTCGACTTTTACCGAAGAAACGACCGC
AGCGCACTGGTGTTGCCGCCCAAGGTATCAGACCTCTTGAAGCAGGGCAAGGCCGTGTGA
Gene >Ophun1|4799
ATGAGCCATTTGCAGCGGGCTTGGGCTCGTTCCAAGCTCGGACTCGCGAATGGCTCCCTCGAAGAAGATGACCAA
GAAGGAAGCATGGCCTCGGAAGAGCACGCTGCTGATGACGACTCCTCGTCGGCCTCGTCGGTTTCGTCCACGGGC
ACCATCATTCCAGCGCCCAGCCAGCGGCTCTTCGCCCGTCCCGAGGGGTAAATCTCGACGTCGTCAGCCTGCGGC
AGAAGTCGATGCTGACTTCGATCTCGCGCCCAGAGTCGCTCGCGGCCGAGCTCTGGACCCCATTCCCTGGACAAC
CTACTTCGAGCGCGAACTGTTCCTCTCCCCTCCCGCCGAGCCGGCCGTCACCTTTCACGCCTATCTCAGCTCGCC
CGTCGACAAGGGCGTGCTTTTCGTCATGCATCACGGCGCCGGATCCTCCGGCCTCACCTTCGCCGTCGTCGGCGC
CGAGATTCGCAAAAGCCTGCCCTCGGCCGGTATCCTTGCCGTCGACTGCAGGGGTCACGGTTCCACCGTCTCGCC
AGAGGGCCAGGCTCTTGATCTCCGGCTGCAGACGCTTTCGTCCGATCTCTTCACCGTCATTCAAATGACAAAGGA
CCAGATGGGATGGAAACAATTGCCCAACATCATCCTCGTCGGACACTCTCTTGGCGGCGCCGTCGTCACCGACCT
GGCCATGACCGGCGAGCTTGGCAACTCCCTGCTGGGCTATGTCGTCCTCGACGTCGTCGAAGGTTCCGCCATGGA
CGCACTGCAGAGCATGCACACCTACCTCTCGTCCAGGCCAACAGGCTTCGCCTCGCTGCAGGCCGCCATCGACTG
GCACATCCGCTCGAGGACCGTGCGCAACTCCATCTCGGCCAGGACCTCGGTCGGCCCCCTCCTCAGGCTGGACGA
AGGCGCTGATCCCTCCCGGCCCTGGGTTTGGAGGACGAATCTTTCGGCCACGCAGCCCTTCTGGGAGGGCTGGTT
CGTCGGTCTCAGCAGCAAGTTCTTGCGGGCCAAGGGCGGCAAGCTGCTCCTCCTGGCTGGCACCGATCGGCTCGA
TACCGAGCTGACAATTGGTCAGATGCAGGGTAGGTTGTGTCGCACGACGCCAGAGCCCGCGCGACCAGGGATCAT
GAGTGAATGACGGGCTGCTAACAACGTTTTCAAGGCAAATATGCGCTGCAAGTGTTTCCGGAAGCCGGTCACTTC
ATCCAGGAGGACATCCCCACCCAGACGGCCACCTCGCTCGTCGACTTTTACCGAAGAAACGACCGCAGCGCACTG
GTGTTGCCGCCCAAGGTATCAGACCTCTTGAAGCAGGGCAAGGCCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail