Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4796
Gene name
LocationContig_45:50065..51419
Strand+
Gene length (bp)1354
Transcript length (bp)504
Coding sequence length (bp)504
Protein length (aa) 168

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60156|SEN34_SCHPO Probable tRNA-splicing endonuclease subunit sen34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen34 PE=3 SV=1 12 94 6.0E-15
sp|Q7SAK9|SEN34_NEUCR Probable tRNA-splicing endonuclease subunit tsp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tsp-4 PE=3 SV=1 1 99 9.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 127 149 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4796
MPGPETPTTIRVCNVAGKFLVFDLESVALLRRDLNTSGVLVGTTPQQPTQNMFLGLPVELDPSEAEALVRCDAAC
VIDTADAHRELLRAQSVDETIRDSKFVFVFVFVFVFVFVFVFVFVFVFVFVFVFVFVFVFVFVFVFVLLPALLLR
VYGALNDLLFGRVEHYV*
Coding >Ophun1|4796
ATGCCGGGGCCTGAAACCCCAACTACAATTCGCGTTTGCAATGTCGCAGGAAAGTTCCTCGTCTTTGATCTCGAA
AGTGTAGCGTTGCTTCGTCGGGATCTTAATACCAGCGGTGTACTGGTGGGAACGACGCCTCAGCAACCTACACAG
AACATGTTCTTGGGCTTGCCCGTTGAACTCGATCCATCCGAGGCCGAAGCCCTTGTTCGATGCGACGCAGCTTGT
GTCATAGATACTGCTGATGCTCATCGTGAATTATTGCGAGCACAATCTGTCGACGAAACGATCCGAGATTCTAAA
TTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTC
GTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTGCTACCCGCGTTATTGCTACGA
GTCTACGGAGCATTAAACGATTTATTATTCGGTAGAGTCGAGCACTACGTATAG
Transcript >Ophun1|4796
ATGCCGGGGCCTGAAACCCCAACTACAATTCGCGTTTGCAATGTCGCAGGAAAGTTCCTCGTCTTTGATCTCGAA
AGTGTAGCGTTGCTTCGTCGGGATCTTAATACCAGCGGTGTACTGGTGGGAACGACGCCTCAGCAACCTACACAG
AACATGTTCTTGGGCTTGCCCGTTGAACTCGATCCATCCGAGGCCGAAGCCCTTGTTCGATGCGACGCAGCTTGT
GTCATAGATACTGCTGATGCTCATCGTGAATTATTGCGAGCACAATCTGTCGACGAAACGATCCGAGATTCTAAA
TTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTC
GTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTGCTACCCGCGTTATTGCTACGA
GTCTACGGAGCATTAAACGATTTATTATTCGGTAGAGTCGAGCACTACGTATAG
Gene >Ophun1|4796
ATGCCGGGGCCTGAAACCCCAACTACAATTCGCGTTTGCAATGTCGCAGGAAAGTTCCTCGTCTTTGATCTCGAA
AGTGTAGCGTTGCTTCGTCGGGATCTTAATACCAGCGGTGTACTGGTGGGAACGACGCCTCAGCAACCTACACAG
AACATGTTCTTGGGCTTGCCCGTTGAACTCGATCCATCCGAGGCCGAAGCCCTTGTTCGATGCGACGCAGCTTGT
GTCATAGATACTGCTGATGCTCATCGTGAATTATTGCGAGCACAATCTGTCGACGAAACGATCCGAGATTCGTAC
GTCAGAACTTTACGCCAGCGAAAACGCGCGGCATGTATGTCACGTCACGTTCATAGTGCCAAACCCACATCGAAT
AATGAGAATGGATGCCGAGCGCATCTGCCCACAACAAATTCTACGCCGTCAAACTATAGGTCGGGGGATGTCCAC
GACGAATCGTTGAGTAGACCGAAACCTGTCACTAGCCAACATGGAGCAATTACAGACAGCACGTCAGACATGTCC
TTTGGTGTTACTTTATCATCTTCTATCGATCTAACGAGACCGGGGATCGGGGAGCGGCGCAGCACAGCCAAAGGG
AAGGAGTCACTAATTAGTGAACTCTTTCGCAACCGAGGCTACTATTTTACTCCCGGACTTCGCTTTGGCGCTCAC
TTCAGCGTATATCCCGGCGACCCATTACGCTTTCACGCACATTTTCTGTCGAACAAGTACGAATGGCACAGCCAA
ATCCCATTACTAGATATAGTAGGCAGCGGAAGACTTGCAACTGCGGTTAAAAAGTCATTCCTAGTTAGCGGTCTT
CAAAACGAAGATTTTCACACGTTTAGCATAGAGTGGGCAGGGATGTAATATAAATCAAGCATAGTAATCTTTCTT
ATAAGGAAAGCTTGACAATAATACACTCTGTGTGCCGTGTTTGATTGTTTAAAAAGAGGCTAATGAGTCTTTTAG
GCCCTAAATCGAGCTAATAGGTAAAAAAGACGGCGATTTATATTATAGCATAAGAAGATACACCGCCCTTCGTAA
AGTTACTACGAAGGTCCGTCCGGAAAGTAATCATAACGCCTTAAGTTACTTTATACCCCTCTTACCGTGTAACCC
TAACCCTAGTACGTAGTTAAGTAAATTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTT
CGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGTCTTCGT
CTTGCTACCCGCGTTATTGCTACGAGTCTACGGAGCATTAAACGATTTATTATTCGGTAGAGTCGAGCACTACGT
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail