Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4787
Gene name
LocationContig_45:25903..27430
Strand+
Gene length (bp)1527
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 1.0E-12 177 249
PF09011 HMG_box_2 HMG-box domain 1.3E-04 176 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870J1|STE11_PNECA HMG-box protein STE11 OS=Pneumocystis carinii PE=1 SV=1 180 262 3.0E-09
sp|P43267|SOX15_MOUSE Protein SOX-15 OS=Mus musculus GN=Sox15 PE=1 SV=3 176 277 7.0E-08
sp|P36631|STE11_SCHPO Transcription factor ste11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste11 PE=1 SV=2 177 253 9.0E-08
sp|P36389|SRY_HORSE Sex-determining region Y protein OS=Equus caballus GN=SRY PE=2 SV=2 160 285 1.0E-07
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 158 256 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870J1|STE11_PNECA HMG-box protein STE11 OS=Pneumocystis carinii PE=1 SV=1 180 262 3.0E-09
sp|P43267|SOX15_MOUSE Protein SOX-15 OS=Mus musculus GN=Sox15 PE=1 SV=3 176 277 7.0E-08
sp|P36631|STE11_SCHPO Transcription factor ste11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste11 PE=1 SV=2 177 253 9.0E-08
sp|P36389|SRY_HORSE Sex-determining region Y protein OS=Equus caballus GN=SRY PE=2 SV=2 160 285 1.0E-07
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 158 256 2.0E-07
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 158 256 2.0E-07
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 158 256 2.0E-07
sp|Q6WRX6|MATMC_SCHKA Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces kambucha GN=matMc PE=3 SV=1 158 256 3.0E-07
sp|Q08143|SMR2_PODAS Sporulation minus regulator 2 OS=Podospora anserina GN=SMR2 PE=3 SV=1 163 273 4.0E-07
sp|Q6EJB7|SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio GN=sox3 PE=1 SV=1 168 253 9.0E-07
sp|P40650|SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis GN=sox11-b PE=1 SV=2 175 273 1.0E-06
sp|P47792|SX19A_DANRE Transcription factor Sox-19a OS=Danio rerio GN=sox19a PE=1 SV=2 176 257 2.0E-06
sp|Q9DDD7|SX19B_DANRE Transcription factor Sox-19b OS=Danio rerio GN=sox19b PE=1 SV=1 176 260 3.0E-06
sp|O60248|SOX15_HUMAN Protein SOX-15 OS=Homo sapiens GN=SOX15 PE=1 SV=1 176 262 4.0E-06
sp|Q5A220|RFG1_CANAL Repressor of filamentous growth 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFG1 PE=2 SV=2 176 260 5.0E-06
sp|P0C1G9|SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus GN=Sox11 PE=2 SV=1 175 259 5.0E-06
sp|O42601|S17B1_XENLA Transcription factor Sox-17-beta.1 OS=Xenopus laevis GN=sox17b.1 PE=1 SV=1 174 265 6.0E-06
sp|Q7M6Y2|SOX11_MOUSE Transcription factor SOX-11 OS=Mus musculus GN=Sox11 PE=1 SV=1 175 259 6.0E-06
sp|Q05066|SRY_HUMAN Sex-determining region Y protein OS=Homo sapiens GN=SRY PE=1 SV=1 165 253 6.0E-06
sp|Q06831|SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus GN=Sox4 PE=1 SV=2 175 264 8.0E-06
sp|Q68FA4|SOX3_XENTR Transcription factor Sox-3 OS=Xenopus tropicalis GN=sox3 PE=2 SV=1 176 253 8.0E-06
sp|Q9BG90|SRY_MACMU Sex-determining region Y protein OS=Macaca mulatta GN=SRY PE=2 SV=1 176 253 8.0E-06
sp|P25042|ROX1_YEAST Repressor ROX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROX1 PE=1 SV=1 176 252 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4982
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3496
Ophiocordyceps australis map64 (Brazil) OphauB2|3663
Ophiocordyceps camponoti-floridani Ophcf2|05612
Ophiocordyceps camponoti-rufipedis Ophun1|4787 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2186

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4787
MRSGVYQPLPGVVAGELFEPDLFGYPNLLFGGGMAYRACQEEPRSSMNFRAPTSSPQLPIISREQGQVSSFTHAL
FTPETSPLLSTDGEDFTTTRQLPTESGRSCVGNSCRREVGRIEKRRKAPRSGTKPGMLDKYIQLDKPLSECIKDE
GDTEVFDVFAHVHRETRKNEVGNDGKVKRPLNAFLLYRKHVIIFVKKKFLQEENKNNQQLVSRICGDSWKMETDE
VKAKFKKLAQEEKSRHGEAFPLYKYTPKTIKKTENDGDGIKSETGARSASAGGRTLDSASPDAVKDPFEASYGSQ
PRAGLHEPRILQESHVESSYTFATQPPVGIGGQGQLQYTGYHDEAGATPDYTYGWSHNGLPQAGSYGLEASVDMQ
PRAVPVSNHELYIDPTLLPRVEEPVYHWHTNDDVLHENQGSWNPQSYMSNMVAAMPDLDINGAHEAYLKGGQEDW
ETSQLGESDSFNDWMMQQENAN*
Coding >Ophun1|4787
ATGCGTTCCGGCGTCTATCAACCTTTACCTGGCGTTGTCGCTGGTGAGCTCTTTGAACCGGATCTGTTTGGATAT
CCCAACTTACTCTTCGGAGGCGGTATGGCTTACAGGGCGTGTCAAGAAGAGCCCCGGTCTTCGATGAATTTCCGC
GCTCCCACGTCGTCTCCTCAACTACCCATCATCAGCCGTGAACAAGGTCAAGTTTCAAGTTTTACTCATGCCCTG
TTTACACCCGAGACGTCACCGCTGTTGTCGACAGATGGGGAGGACTTCACCACGACCCGCCAGCTTCCGACCGAG
TCCGGGAGGAGCTGCGTCGGCAATTCATGCCGGAGAGAAGTCGGCCGTATCGAGAAAAGACGCAAGGCACCTAGA
AGCGGGACGAAACCCGGGATGCTCGACAAGTATATCCAGCTCGACAAGCCGCTGAGCGAATGCATCAAAGACGAA
GGCGATACCGAGGTCTTTGACGTCTTTGCCCATGTCCACCGAGAGACACGCAAGAATGAGGTGGGCAACGACGGC
AAAGTCAAGAGACCACTCAACGCCTTTCTTCTTTACCGGAAGCACGTCATCATCTTCGTCAAGAAGAAGTTCCTG
CAGGAGGAGAACAAGAACAACCAGCAGCTCGTTTCGAGAATATGTGGCGATTCGTGGAAGATGGAGACGGATGAG
GTCAAGGCCAAGTTCAAGAAGTTGGCGCAAGAGGAGAAGTCGAGGCACGGAGAGGCCTTTCCGCTTTACAAGTAT
ACGCCAAAGACGATCAAGAAGACGGAAAATGACGGAGATGGCATCAAATCGGAAACCGGTGCGAGGTCAGCGTCT
GCTGGTGGCAGGACCCTGGATTCCGCTTCCCCGGACGCGGTCAAGGACCCCTTCGAAGCCAGCTACGGATCTCAG
CCGCGTGCTGGTCTGCATGAGCCCCGGATTTTGCAGGAGTCGCACGTCGAGAGCTCGTACACGTTTGCGACTCAG
CCTCCCGTTGGCATTGGCGGACAGGGGCAGCTGCAGTATACTGGATACCACGACGAAGCTGGCGCCACACCCGAT
TATACATATGGCTGGAGCCACAACGGACTGCCGCAGGCTGGCAGCTATGGTCTGGAGGCGTCAGTGGATATGCAA
CCGCGCGCGGTCCCCGTCAGCAACCACGAGCTCTACATTGACCCAACCCTCCTACCCAGGGTAGAGGAGCCAGTG
TATCATTGGCATACCAATGATGATGTCTTGCACGAGAACCAAGGCAGCTGGAATCCGCAGAGCTACATGAGTAAC
ATGGTGGCCGCCATGCCGGACCTGGACATCAATGGCGCACACGAGGCGTACCTAAAAGGAGGACAGGAAGACTGG
GAGACTTCGCAGCTGGGCGAGTCCGATAGCTTCAACGACTGGATGATGCAGCAGGAAAACGCCAATTGA
Transcript >Ophun1|4787
ATGCGTTCCGGCGTCTATCAACCTTTACCTGGCGTTGTCGCTGGTGAGCTCTTTGAACCGGATCTGTTTGGATAT
CCCAACTTACTCTTCGGAGGCGGTATGGCTTACAGGGCGTGTCAAGAAGAGCCCCGGTCTTCGATGAATTTCCGC
GCTCCCACGTCGTCTCCTCAACTACCCATCATCAGCCGTGAACAAGGTCAAGTTTCAAGTTTTACTCATGCCCTG
TTTACACCCGAGACGTCACCGCTGTTGTCGACAGATGGGGAGGACTTCACCACGACCCGCCAGCTTCCGACCGAG
TCCGGGAGGAGCTGCGTCGGCAATTCATGCCGGAGAGAAGTCGGCCGTATCGAGAAAAGACGCAAGGCACCTAGA
AGCGGGACGAAACCCGGGATGCTCGACAAGTATATCCAGCTCGACAAGCCGCTGAGCGAATGCATCAAAGACGAA
GGCGATACCGAGGTCTTTGACGTCTTTGCCCATGTCCACCGAGAGACACGCAAGAATGAGGTGGGCAACGACGGC
AAAGTCAAGAGACCACTCAACGCCTTTCTTCTTTACCGGAAGCACGTCATCATCTTCGTCAAGAAGAAGTTCCTG
CAGGAGGAGAACAAGAACAACCAGCAGCTCGTTTCGAGAATATGTGGCGATTCGTGGAAGATGGAGACGGATGAG
GTCAAGGCCAAGTTCAAGAAGTTGGCGCAAGAGGAGAAGTCGAGGCACGGAGAGGCCTTTCCGCTTTACAAGTAT
ACGCCAAAGACGATCAAGAAGACGGAAAATGACGGAGATGGCATCAAATCGGAAACCGGTGCGAGGTCAGCGTCT
GCTGGTGGCAGGACCCTGGATTCCGCTTCCCCGGACGCGGTCAAGGACCCCTTCGAAGCCAGCTACGGATCTCAG
CCGCGTGCTGGTCTGCATGAGCCCCGGATTTTGCAGGAGTCGCACGTCGAGAGCTCGTACACGTTTGCGACTCAG
CCTCCCGTTGGCATTGGCGGACAGGGGCAGCTGCAGTATACTGGATACCACGACGAAGCTGGCGCCACACCCGAT
TATACATATGGCTGGAGCCACAACGGACTGCCGCAGGCTGGCAGCTATGGTCTGGAGGCGTCAGTGGATATGCAA
CCGCGCGCGGTCCCCGTCAGCAACCACGAGCTCTACATTGACCCAACCCTCCTACCCAGGGTAGAGGAGCCAGTG
TATCATTGGCATACCAATGATGATGTCTTGCACGAGAACCAAGGCAGCTGGAATCCGCAGAGCTACATGAGTAAC
ATGGTGGCCGCCATGCCGGACCTGGACATCAATGGCGCACACGAGGCGTACCTAAAAGGAGGACAGGAAGACTGG
GAGACTTCGCAGCTGGGCGAGTCCGATAGCTTCAACGACTGGATGATGCAGCAGGAAAACGCCAATTGA
Gene >Ophun1|4787
ATGCGTTCCGGCGTCTATCAACCTTTACCTGGCGTTGTCGCTGGTGAGCTCTTTGAACCGGATCTGTTTGGATAT
CCCAACTTACTCTTCGGAGGCGGTATGGCTTACAGGGCGTGTCAAGAAGAGCCCCGGTCTTCGGTCAGTCGATTC
GTCTCGATTCGTCCTCGTGTGCGTGCGATGCTGACCCTGATAGATGAATTTCCGCGCTCCCACGTCGTCTCCTCA
ACTACCCATCATCAGCCGTGAACAAGGTCAAGTTTCAAGTTTTGTAAGTCAGGATGCAAGGGAACAAACGAGGCA
GATTGCTGACGCGATAACCAGACTCATGCCCTGTTTACACCCGAGACGTCACCGCTGTTGTCGACAGATGGGGAG
GACTTCACCACGACCCGCCAGCTTCCGACCGAGTCCGGGAGGAGCTGCGTCGGCAATTCATGCCGGAGAGAAGTC
GGCCGTATCGAGAAAAGACGCAAGGCACCTAGAAGCGGGACGAAACCCGGGATGCTCGACAAGTATATCCAGCTC
GACAAGCCGCTGAGCGAATGCATCAAAGACGAAGGCGATACCGAGGTCTTTGACGTCTTTGCCCATGTCCACCGA
GAGACACGCAAGAATGAGGTGGGCAACGACGGCAAAGTCAAGAGACCACTCAACGCCTTTCTTCTTTACCGGAAG
CACGTCATCATCTTCGTCAAGAAGAAGTTCCTGCAGGAGGAGAACAAGAACAACCAGCAGCTCGTTTCGAGAATA
TGTGGCGATTCGTGGAAGATGGAGACGGATGAGGTCAAGGCCAAGTTCAAGAAGTTGGCGCAAGAGGAGAAGTCG
AGGCACGGAGAGGCCTTTCCGCTTTACAAGTATACGCCAAAGACGATCAAGAAGACGGAAAATGACGGAGATGGC
ATCAAATCGGAAACCGGTGCGAGGTCAGCGTCTGCTGGTGGCAGGACCCTGGATTCCGCTTCCCCGGACGCGGTC
AAGGACCCCTTCGAAGCCAGCTACGGATCTCAGCCGCGTGCTGGTCTGCATGAGCCCCGGATTTTGCAGGAGTCG
CACGTCGAGAGCTCGTACACGTTTGCGACTCAGCCTCCCGTTGGCATTGGCGGACAGGGGCAGCTGCAGTATACT
GGATACCACGACGAAGCTGGCGCCACACCCGATTATACATATGGCTGGAGCCACAACGGACTGCCGCAGGCTGGC
AGCTATGGTCTGGAGGCGTCAGTGGATATGCAACCGCGCGCGGTCCCCGTCAGCAACCACGAGCTCTACATTGAC
CCAACCCTCCTACCCAGGGTAGAGGAGCCAGTGTATCATTGGCATACCAATGATGATGTCTTGCACGAGAACCAA
GGCAGCTGGAATCCGCAGAGCTACATGAGTAACATGGTGGCCGCCATGCCGGACCTGGACATCAATGGCGCACAC
GAGGCGTACCTAAAAGGAGGACAGGAAGACTGGGAGACTTCGCAGCTGGGCGAGTCCGATAGCTTCAACGACTGG
ATGATGCAGCAGGAAAACGCCAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail