Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4782
Gene name
LocationContig_45:11547..13011
Strand-
Gene length (bp)1464
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00206 Lyase_1 Lyase 2.2E-83 5 301
PF14698 ASL_C2 Argininosuccinate lyase C-terminal 6.9E-25 363 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50514|ARLZ_SCHPO Probable argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=argx PE=3 SV=1 2 456 0.0E+00
sp|P43061|ARLY_CANAX Argininosuccinate lyase OS=Candida albicans GN=ARG4 PE=3 SV=1 2 455 0.0E+00
sp|P41906|ARLY_SACPA Argininosuccinate lyase OS=Saccharomyces paradoxus GN=ARG4 PE=3 SV=1 2 456 0.0E+00
sp|P04076|ARLY_YEAST Argininosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG4 PE=1 SV=2 2 455 0.0E+00
sp|P40369|ARLY_SCHPO Argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg7 PE=3 SV=2 2 455 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50514|ARLZ_SCHPO Probable argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=argx PE=3 SV=1 2 456 0.0E+00
sp|P43061|ARLY_CANAX Argininosuccinate lyase OS=Candida albicans GN=ARG4 PE=3 SV=1 2 455 0.0E+00
sp|P41906|ARLY_SACPA Argininosuccinate lyase OS=Saccharomyces paradoxus GN=ARG4 PE=3 SV=1 2 456 0.0E+00
sp|P04076|ARLY_YEAST Argininosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG4 PE=1 SV=2 2 455 0.0E+00
sp|P40369|ARLY_SCHPO Argininosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg7 PE=3 SV=2 2 455 0.0E+00
sp|P51464|ARLY_LITCT Argininosuccinate lyase OS=Lithobates catesbeiana GN=ASL PE=3 SV=1 2 461 0.0E+00
sp|P24058|ARLY2_ANAPL Argininosuccinate lyase OS=Anas platyrhynchos GN=ASL2 PE=1 SV=4 2 459 0.0E+00
sp|P05083|ARLY2_CHICK Argininosuccinate lyase OS=Gallus gallus GN=ASL2 PE=2 SV=1 2 459 6.0E-178
sp|Q91YI0|ARLY_MOUSE Argininosuccinate lyase OS=Mus musculus GN=Asl PE=1 SV=1 2 456 7.0E-177
sp|P33110|ARLY_ANSAN Argininosuccinate lyase OS=Anser anser anser GN=ASL PE=1 SV=1 2 459 1.0E-176
sp|P20673|ARLY_RAT Argininosuccinate lyase OS=Rattus norvegicus GN=Asl PE=2 SV=1 2 457 3.0E-175
sp|Q3SZJ0|ARLY_BOVIN Argininosuccinate lyase OS=Bos taurus GN=ASL PE=2 SV=1 2 456 3.0E-175
sp|P24057|ARLY1_ANAPL Delta-1 crystallin OS=Anas platyrhynchos GN=ASL1 PE=1 SV=1 2 459 3.0E-175
sp|Q60HH3|ARLY_MACFA Argininosuccinate lyase OS=Macaca fascicularis GN=ASL PE=2 SV=1 2 459 8.0E-175
sp|P04424|ARLY_HUMAN Argininosuccinate lyase OS=Homo sapiens GN=ASL PE=1 SV=4 2 456 2.0E-173
sp|Q01592|ARLY_COLLI Argininosuccinate lyase OS=Columba livia GN=ASL PE=1 SV=1 2 459 1.0E-170
sp|P22675|ARLY_CHLRE Argininosuccinate lyase OS=Chlamydomonas reinhardtii GN=ARG7 PE=2 SV=2 2 455 2.0E-170
sp|P02521|ARLY1_CHICK Delta-1 crystallin OS=Gallus gallus GN=ASL1 PE=1 SV=2 2 459 1.0E-164
sp|Q7SIE0|ARLY1_MELGA Delta-1 crystallin OS=Meleagris gallopavo GN=ASL1 PE=1 SV=1 2 459 4.0E-164
sp|A5UVX7|ARLY_ROSS1 Argininosuccinate lyase OS=Roseiflexus sp. (strain RS-1) GN=argH PE=3 SV=1 2 452 1.0E-146
sp|A7NF38|ARLY_ROSCS Argininosuccinate lyase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=argH PE=3 SV=1 2 455 7.0E-144
sp|Q8R7C3|ARLY_CALS4 Argininosuccinate lyase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argH PE=3 SV=1 2 438 3.0E-137
sp|A9AWL1|ARLY_HERA2 Argininosuccinate lyase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=argH PE=3 SV=1 2 448 2.0E-136
sp|Q8GDU5|ARLY_HELMO Argininosuccinate lyase (Fragment) OS=Heliobacillus mobilis PE=3 SV=1 2 455 3.0E-133
sp|B8GD12|ARLY_CHLAD Argininosuccinate lyase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=argH PE=3 SV=1 2 459 5.0E-133
sp|B9LD91|ARLY_CHLSY Argininosuccinate lyase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=argH PE=3 SV=1 2 455 7.0E-133
sp|A9WJR8|ARLY_CHLAA Argininosuccinate lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=argH PE=3 SV=1 2 455 7.0E-133
sp|A7ZC90|ARLY_CAMC1 Argininosuccinate lyase OS=Campylobacter concisus (strain 13826) GN=argH PE=3 SV=1 2 456 7.0E-132
sp|B8DN65|ARLY_DESVM Argininosuccinate lyase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=argH PE=3 SV=1 2 456 3.0E-131
sp|Q98G36|ARLY1_RHILO Argininosuccinate lyase 1 OS=Rhizobium loti (strain MAFF303099) GN=argH1 PE=3 SV=1 2 449 5.0E-131
sp|Q67S72|ARLY_SYMTH Argininosuccinate lyase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=argH PE=3 SV=1 2 455 2.0E-130
sp|B0K4D9|ARLY_THEPX Argininosuccinate lyase OS=Thermoanaerobacter sp. (strain X514) GN=argH PE=3 SV=1 2 425 2.0E-130
sp|B0KBW6|ARLY_THEP3 Argininosuccinate lyase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=argH PE=3 SV=1 2 425 2.0E-130
sp|Q65G68|ARLY_BACLD Argininosuccinate lyase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=argH PE=3 SV=1 2 455 6.0E-130
sp|A7I3C8|ARLY_CAMHC Argininosuccinate lyase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=argH PE=3 SV=1 2 456 8.0E-130
sp|B8IZS3|ARLY_DESDA Argininosuccinate lyase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=argH PE=3 SV=1 3 455 1.0E-129
sp|A7Z7L9|ARLY_BACMF Argininosuccinate lyase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=argH PE=3 SV=1 2 439 4.0E-129
sp|B9JTJ2|ARLY_AGRVS Argininosuccinate lyase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=argH PE=3 SV=1 2 452 1.0E-128
sp|O34858|ARLY_BACSU Argininosuccinate lyase OS=Bacillus subtilis (strain 168) GN=argH PE=3 SV=1 2 449 2.0E-128
sp|Q817C7|ARLY_BACCR Argininosuccinate lyase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argH PE=3 SV=1 2 449 2.0E-128
sp|Q3A1V0|ARLY_PELCD Argininosuccinate lyase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=argH PE=3 SV=1 3 448 3.0E-128
sp|A1VEQ1|ARLY_DESVV Argininosuccinate lyase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=argH PE=3 SV=1 2 451 5.0E-128
sp|Q72D36|ARLY_DESVH Argininosuccinate lyase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argH PE=3 SV=1 2 451 5.0E-128
sp|B7H6Y4|ARLY_BACC4 Argininosuccinate lyase OS=Bacillus cereus (strain B4264) GN=argH PE=3 SV=1 2 449 6.0E-128
sp|Q929S8|ARLY_LISIN Argininosuccinate lyase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argH PE=3 SV=1 2 439 6.0E-128
sp|A7GXA8|ARLY_CAMC5 Argininosuccinate lyase OS=Campylobacter curvus (strain 525.92) GN=argH PE=3 SV=1 2 458 9.0E-128
sp|B9M377|ARLY_GEODF Argininosuccinate lyase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=argH PE=3 SV=1 2 452 1.0E-127
sp|Q2NQZ1|ARLY_SODGM Argininosuccinate lyase OS=Sodalis glossinidius (strain morsitans) GN=argH PE=3 SV=1 2 448 2.0E-127
sp|P57909|ARLY_PASMU Argininosuccinate lyase OS=Pasteurella multocida (strain Pm70) GN=argH PE=3 SV=1 2 448 2.0E-127
sp|B7HRS6|ARLY_BACC7 Argininosuccinate lyase OS=Bacillus cereus (strain AH187) GN=argH PE=3 SV=1 2 439 3.0E-127
sp|A8FG69|ARLY_BACP2 Argininosuccinate lyase OS=Bacillus pumilus (strain SAFR-032) GN=argH PE=3 SV=1 2 439 3.0E-127
sp|Q633G5|ARLY_BACCZ Argininosuccinate lyase OS=Bacillus cereus (strain ZK / E33L) GN=argH PE=3 SV=1 2 456 3.0E-127
sp|A7GTR4|ARLY_BACCN Argininosuccinate lyase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=argH PE=3 SV=1 2 439 4.0E-127
sp|A9VKE0|ARLY_BACWK Argininosuccinate lyase OS=Bacillus weihenstephanensis (strain KBAB4) GN=argH PE=3 SV=1 2 439 4.0E-127
sp|B7IK28|ARLY_BACC2 Argininosuccinate lyase OS=Bacillus cereus (strain G9842) GN=argH PE=3 SV=1 2 449 5.0E-127
sp|Q81KV8|ARLY_BACAN Argininosuccinate lyase OS=Bacillus anthracis GN=argH-2 PE=3 SV=1 2 456 6.0E-127
sp|C3L913|ARLY_BACAC Argininosuccinate lyase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=argH PE=3 SV=1 2 456 6.0E-127
sp|C3PB96|ARLY_BACAA Argininosuccinate lyase OS=Bacillus anthracis (strain A0248) GN=argH PE=3 SV=1 2 456 6.0E-127
sp|A9MHH3|ARLY_SALAR Argininosuccinate lyase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=argH PE=3 SV=1 2 448 8.0E-127
sp|Q72ZA4|ARLY_BACC1 Argininosuccinate lyase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=argH PE=3 SV=1 2 456 8.0E-127
sp|A5GDA7|ARLY_GEOUR Argininosuccinate lyase OS=Geobacter uraniireducens (strain Rf4) GN=argH PE=3 SV=1 2 449 1.0E-126
sp|Q24ZG7|ARLY_DESHY Argininosuccinate lyase OS=Desulfitobacterium hafniense (strain Y51) GN=argH PE=3 SV=1 2 448 1.0E-126
sp|B8FWX3|ARLY_DESHD Argininosuccinate lyase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=argH PE=3 SV=1 2 448 1.0E-126
sp|B5F0U9|ARLY_SALA4 Argininosuccinate lyase OS=Salmonella agona (strain SL483) GN=argH PE=3 SV=1 2 448 1.0E-126
sp|Q92MH1|ARLY1_RHIME Argininosuccinate lyase 1 OS=Rhizobium meliloti (strain 1021) GN=argH1 PE=3 SV=1 2 452 2.0E-126
sp|B7NFR0|ARLY_ECOLU Argininosuccinate lyase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|P11447|ARLY_ECOLI Argininosuccinate lyase OS=Escherichia coli (strain K12) GN=argH PE=1 SV=3 2 448 2.0E-126
sp|B1IVB8|ARLY_ECOLC Argininosuccinate lyase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|A8A768|ARLY_ECOHS Argininosuccinate lyase OS=Escherichia coli O9:H4 (strain HS) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|B1XBC5|ARLY_ECODH Argininosuccinate lyase OS=Escherichia coli (strain K12 / DH10B) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|C5A0Q9|ARLY_ECOBW Argininosuccinate lyase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|A6Q2R2|ARLY_NITSB Argininosuccinate lyase OS=Nitratiruptor sp. (strain SB155-2) GN=argH PE=3 SV=1 2 456 2.0E-126
sp|B6I5H6|ARLY_ECOSE Argininosuccinate lyase OS=Escherichia coli (strain SE11) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|B7M714|ARLY_ECO8A Argininosuccinate lyase OS=Escherichia coli O8 (strain IAI1) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|B7LA60|ARLY_ECO55 Argininosuccinate lyase OS=Escherichia coli (strain 55989 / EAEC) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|A7ZUH8|ARLY_ECO24 Argininosuccinate lyase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|B7LUN5|ARLY_ESCF3 Argininosuccinate lyase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=argH PE=3 SV=1 2 448 2.0E-126
sp|Q11DW5|ARLY_CHESB Argininosuccinate lyase OS=Chelativorans sp. (strain BNC1) GN=argH PE=3 SV=1 2 456 3.0E-126
sp|Q39Z69|ARLY_GEOMG Argininosuccinate lyase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argH PE=3 SV=1 2 452 3.0E-126
sp|B5Z062|ARLY_ECO5E Argininosuccinate lyase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=argH PE=3 SV=1 2 455 4.0E-126
sp|Q2RG68|ARLY_MOOTA Argininosuccinate lyase OS=Moorella thermoacetica (strain ATCC 39073) GN=argH PE=3 SV=1 2 455 4.0E-126
sp|P59619|ARLY_SHIFL Argininosuccinate lyase OS=Shigella flexneri GN=argH PE=3 SV=1 2 448 5.0E-126
sp|Q0SY34|ARLY_SHIF8 Argininosuccinate lyase OS=Shigella flexneri serotype 5b (strain 8401) GN=argH PE=3 SV=1 2 448 5.0E-126
sp|A9N0H0|ARLY_SALPB Argininosuccinate lyase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=argH PE=3 SV=1 2 457 5.0E-126
sp|C0Q476|ARLY_SALPC Argininosuccinate lyase OS=Salmonella paratyphi C (strain RKS4594) GN=argH PE=3 SV=1 2 448 5.0E-126
sp|Q57H93|ARLY_SALCH Argininosuccinate lyase OS=Salmonella choleraesuis (strain SC-B67) GN=argH PE=3 SV=1 2 448 5.0E-126
sp|A1ATU1|ARLY_PELPD Argininosuccinate lyase OS=Pelobacter propionicus (strain DSM 2379) GN=argH PE=3 SV=1 2 452 5.0E-126
sp|Q32AB5|ARLY_SHIDS Argininosuccinate lyase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=argH PE=3 SV=1 2 448 6.0E-126
sp|B7JS05|ARLY_BACC0 Argininosuccinate lyase OS=Bacillus cereus (strain AH820) GN=argH PE=3 SV=1 2 456 6.0E-126
sp|B4TCQ6|ARLY_SALHS Argininosuccinate lyase OS=Salmonella heidelberg (strain SL476) GN=argH PE=3 SV=1 2 448 6.0E-126
sp|B5RF45|ARLY_SALG2 Argininosuccinate lyase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=argH PE=3 SV=1 2 457 6.0E-126
sp|B5QXQ5|ARLY_SALEP Argininosuccinate lyase OS=Salmonella enteritidis PT4 (strain P125109) GN=argH PE=3 SV=1 2 457 6.0E-126
sp|B5FPX5|ARLY_SALDC Argininosuccinate lyase OS=Salmonella dublin (strain CT_02021853) GN=argH PE=3 SV=1 2 457 6.0E-126
sp|B3E9X6|ARLY_GEOLS Argininosuccinate lyase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=argH PE=3 SV=1 2 453 8.0E-126
sp|B4TQH6|ARLY_SALSV Argininosuccinate lyase OS=Salmonella schwarzengrund (strain CVM19633) GN=argH PE=3 SV=1 2 457 1.0E-125
sp|B2TWF5|ARLY_SHIB3 Argininosuccinate lyase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=argH PE=3 SV=1 2 448 1.0E-125
sp|A0RJM3|ARLY_BACAH Argininosuccinate lyase OS=Bacillus thuringiensis (strain Al Hakam) GN=argH PE=3 SV=1 2 468 1.0E-125
sp|Q8ZKL6|ARLY_SALTY Argininosuccinate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argH PE=3 SV=1 2 448 1.0E-125
sp|C3MHU1|ARLY_RHISN Argininosuccinate lyase OS=Rhizobium sp. (strain NGR234) GN=argH PE=3 SV=1 2 452 1.0E-125
sp|B4T0X1|ARLY_SALNS Argininosuccinate lyase OS=Salmonella newport (strain SL254) GN=argH PE=3 SV=1 2 448 2.0E-125
sp|Q3YV16|ARLY_SHISS Argininosuccinate lyase OS=Shigella sonnei (strain Ss046) GN=argH PE=3 SV=1 2 448 2.0E-125
sp|A1UQY9|ARLY_BARBK Argininosuccinate lyase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=argH PE=3 SV=1 2 455 2.0E-125
sp|B7NU40|ARLY_ECO7I Argininosuccinate lyase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=argH PE=3 SV=1 2 448 2.0E-125
sp|C1KX44|ARLY_LISMC Argininosuccinate lyase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=argH PE=3 SV=1 2 439 2.0E-125
sp|B4F1G9|ARLY_PROMH Argininosuccinate lyase OS=Proteus mirabilis (strain HI4320) GN=argH PE=3 SV=1 2 457 2.0E-125
sp|A6M1Z5|ARLY_CLOB8 Argininosuccinate lyase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=argH PE=3 SV=1 2 459 2.0E-125
sp|Q65W16|ARLY_MANSM Argininosuccinate lyase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=argH PE=3 SV=1 2 448 2.0E-125
sp|Q6HCP8|ARLY_BACHK Argininosuccinate lyase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argH PE=3 SV=1 2 439 3.0E-125
sp|A8AKW2|ARLY_CITK8 Argininosuccinate lyase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=argH PE=3 SV=1 2 448 3.0E-125
sp|Q31U28|ARLY_SHIBS Argininosuccinate lyase OS=Shigella boydii serotype 4 (strain Sb227) GN=argH PE=3 SV=1 2 448 4.0E-125
sp|B1YJ36|ARLY_EXIS2 Argininosuccinate lyase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=argH PE=3 SV=1 2 456 4.0E-125
sp|Q74GT9|ARLY_GEOSL Argininosuccinate lyase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argH PE=3 SV=1 2 449 4.0E-125
sp|Q1MQL6|ARLY_LAWIP Argininosuccinate lyase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=argH PE=3 SV=1 2 455 5.0E-125
sp|B5BJN4|ARLY_SALPK Argininosuccinate lyase OS=Salmonella paratyphi A (strain AKU_12601) GN=argH PE=3 SV=1 2 457 7.0E-125
sp|Q5PK73|ARLY_SALPA Argininosuccinate lyase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=argH PE=3 SV=1 2 457 7.0E-125
sp|B7UNT6|ARLY_ECO27 Argininosuccinate lyase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=argH PE=3 SV=1 2 448 7.0E-125
sp|Q2K3P2|ARLY_RHIEC Argininosuccinate lyase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=argH PE=3 SV=1 2 452 9.0E-125
sp|Q71XS3|ARLY_LISMF Argininosuccinate lyase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argH PE=3 SV=1 2 439 9.0E-125
sp|Q15X84|ARLY_PSEA6 Argininosuccinate lyase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=argH PE=3 SV=1 2 448 1.0E-124
sp|Q8Y5H1|ARLY_LISMO Argininosuccinate lyase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argH PE=3 SV=1 2 439 1.0E-124
sp|A5D4Y2|ARLY_PELTS Argininosuccinate lyase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=argH PE=3 SV=1 2 456 2.0E-124
sp|A6TGE4|ARLY_KLEP7 Argininosuccinate lyase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=argH PE=3 SV=1 2 448 2.0E-124
sp|Q8U9X6|ARLY1_AGRFC Argininosuccinate lyase 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argH1 PE=3 SV=2 2 452 3.0E-124
sp|Q1R3V1|ARLY_ECOUT Argininosuccinate lyase OS=Escherichia coli (strain UTI89 / UPEC) GN=argH PE=3 SV=1 2 448 3.0E-124
sp|Q8FB96|ARLY_ECOL6 Argininosuccinate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argH PE=3 SV=1 2 448 3.0E-124
sp|Q0TAA0|ARLY_ECOL5 Argininosuccinate lyase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argH PE=3 SV=1 2 448 3.0E-124
sp|A1AID8|ARLY_ECOK1 Argininosuccinate lyase OS=Escherichia coli O1:K1 / APEC GN=argH PE=3 SV=1 2 448 3.0E-124
sp|B7MR51|ARLY_ECO81 Argininosuccinate lyase OS=Escherichia coli O81 (strain ED1a) GN=argH PE=3 SV=1 2 448 3.0E-124
sp|B7MI96|ARLY_ECO45 Argininosuccinate lyase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argH PE=3 SV=1 2 448 3.0E-124
sp|Q8X730|ARLY_ECO57 Argininosuccinate lyase OS=Escherichia coli O157:H7 GN=argH PE=3 SV=1 2 444 4.0E-124
sp|B5ED16|ARLY_GEOBB Argininosuccinate lyase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=argH PE=3 SV=1 2 448 4.0E-124
sp|B3PPC1|ARLY_RHIE6 Argininosuccinate lyase OS=Rhizobium etli (strain CIAT 652) GN=argH PE=3 SV=1 2 452 4.0E-124
sp|B1I1D1|ARLY_DESAP Argininosuccinate lyase OS=Desulforudis audaxviator (strain MP104C) GN=argH PE=3 SV=1 2 444 4.0E-124
sp|Q8Z311|ARLY_SALTI Argininosuccinate lyase OS=Salmonella typhi GN=argH PE=3 SV=1 2 448 4.0E-124
sp|Q8YJJ7|ARLY_BRUME Argininosuccinate lyase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argH PE=3 SV=1 2 449 5.0E-124
sp|C0RFM4|ARLY_BRUMB Argininosuccinate lyase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=argH PE=3 SV=1 2 449 5.0E-124
sp|Q57AS3|ARLY_BRUAB Argininosuccinate lyase OS=Brucella abortus biovar 1 (strain 9-941) GN=argH PE=3 SV=1 2 449 5.0E-124
sp|Q2YR87|ARLY_BRUA2 Argininosuccinate lyase OS=Brucella abortus (strain 2308) GN=argH PE=3 SV=1 2 449 5.0E-124
sp|B2S8N8|ARLY_BRUA1 Argininosuccinate lyase OS=Brucella abortus (strain S19) GN=argH PE=3 SV=1 2 449 5.0E-124
sp|C6BTR8|ARLY_DESAD Argininosuccinate lyase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=argH PE=3 SV=1 2 456 7.0E-124
sp|A7H3C0|ARLY_CAMJD Argininosuccinate lyase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=argH PE=3 SV=1 2 456 7.0E-124
sp|B8DH27|ARLY_LISMH Argininosuccinate lyase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=argH PE=3 SV=1 2 439 8.0E-124
sp|C6E6Y9|ARLY_GEOSM Argininosuccinate lyase OS=Geobacter sp. (strain M21) GN=argH PE=3 SV=1 2 448 9.0E-124
sp|B4S0H4|ARLY_ALTMD Argininosuccinate lyase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=argH PE=3 SV=1 2 448 9.0E-124
sp|Q5HUM8|ARLY_CAMJR Argininosuccinate lyase OS=Campylobacter jejuni (strain RM1221) GN=argH PE=3 SV=1 2 456 1.0E-123
sp|Q8FYA4|ARLY_BRUSU Argininosuccinate lyase OS=Brucella suis biovar 1 (strain 1330) GN=argH PE=3 SV=1 2 449 1.0E-123
sp|B0CIY4|ARLY_BRUSI Argininosuccinate lyase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=argH PE=3 SV=1 2 449 1.0E-123
sp|A9M968|ARLY_BRUC2 Argininosuccinate lyase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=argH PE=3 SV=1 2 449 1.0E-123
sp|A6WXL6|ARLY_OCHA4 Argininosuccinate lyase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=argH PE=3 SV=1 2 449 1.0E-123
sp|Q46104|ARLY_CAMJE Argininosuccinate lyase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argH PE=3 SV=2 2 456 2.0E-123
sp|Q0I2U1|ARLY_HAES1 Argininosuccinate lyase OS=Haemophilus somnus (strain 129Pt) GN=argH PE=3 SV=1 2 448 3.0E-123
sp|A5UHW3|ARLY_HAEIG Argininosuccinate lyase OS=Haemophilus influenzae (strain PittGG) GN=argH PE=3 SV=1 2 448 3.0E-123
sp|A5UDR3|ARLY_HAEIE Argininosuccinate lyase OS=Haemophilus influenzae (strain PittEE) GN=argH PE=3 SV=1 2 448 4.0E-123
sp|Q1MB73|ARLY_RHIL3 Argininosuccinate lyase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=argH PE=3 SV=2 2 452 7.0E-123
sp|B5XZ16|ARLY_KLEP3 Argininosuccinate lyase OS=Klebsiella pneumoniae (strain 342) GN=argH PE=3 SV=1 2 448 9.0E-123
sp|B0UTI4|ARLY_HISS2 Argininosuccinate lyase OS=Histophilus somni (strain 2336) GN=argH PE=3 SV=1 2 448 9.0E-123
sp|C5D678|ARLY_GEOSW Argininosuccinate lyase OS=Geobacillus sp. (strain WCH70) GN=argH PE=3 SV=1 2 455 1.0E-122
sp|B7K2S1|ARLY_CYAP8 Argininosuccinate lyase OS=Cyanothece sp. (strain PCC 8801) GN=argH PE=3 SV=1 3 458 1.0E-122
sp|A6VKY5|ARLY_ACTSZ Argininosuccinate lyase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=argH PE=3 SV=1 2 448 1.0E-122
sp|C5BC57|ARLY_EDWI9 Argininosuccinate lyase OS=Edwardsiella ictaluri (strain 93-146) GN=argH PE=3 SV=1 2 448 1.0E-122
sp|A9BIA3|ARLY_PETMO Argininosuccinate lyase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=argH PE=3 SV=1 2 438 2.0E-122
sp|A1B3M0|ARLY_PARDP Argininosuccinate lyase OS=Paracoccus denitrificans (strain Pd 1222) GN=argH PE=3 SV=1 2 456 2.0E-122
sp|Q4QM89|ARLY_HAEI8 Argininosuccinate lyase OS=Haemophilus influenzae (strain 86-028NP) GN=argH PE=3 SV=1 2 448 3.0E-122
sp|A6TL09|ARLY_ALKMQ Argininosuccinate lyase OS=Alkaliphilus metalliredigens (strain QYMF) GN=argH PE=3 SV=1 2 444 3.0E-122
sp|A4J174|ARLY_DESRM Argininosuccinate lyase OS=Desulfotomaculum reducens (strain MI-1) GN=argH PE=3 SV=1 2 456 3.0E-122
sp|A3N1I1|ARLY_ACTP2 Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=argH PE=3 SV=1 2 449 4.0E-122
sp|B3GY67|ARLY_ACTP7 Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=argH PE=3 SV=1 2 449 4.0E-122
sp|P44314|ARLY_HAEIN Argininosuccinate lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=argH PE=3 SV=1 2 448 5.0E-122
sp|A7ML84|ARLY_CROS8 Argininosuccinate lyase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=argH PE=3 SV=1 2 448 5.0E-122
sp|Q8XMJ8|ARLY_CLOPE Argininosuccinate lyase OS=Clostridium perfringens (strain 13 / Type A) GN=argH PE=3 SV=1 2 458 5.0E-122
sp|Q0TTA6|ARLY_CLOP1 Argininosuccinate lyase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=argH PE=3 SV=1 2 458 6.0E-122
sp|Q7M938|ARLY_WOLSU Argininosuccinate lyase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argH PE=3 SV=1 2 456 6.0E-122
sp|A8GL81|ARLY_SERP5 Argininosuccinate lyase OS=Serratia proteamaculans (strain 568) GN=argH PE=3 SV=1 2 455 7.0E-122
sp|A7HTI8|ARLY_PARL1 Argininosuccinate lyase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=argH PE=3 SV=1 2 455 8.0E-122
sp|B0BQC2|ARLY_ACTPJ Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=argH PE=3 SV=1 2 449 9.0E-122
sp|A4IRS2|ARLY_GEOTN Argininosuccinate lyase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=argH PE=3 SV=1 2 455 9.0E-122
sp|Q30YB9|ARLY_DESAG Argininosuccinate lyase OS=Desulfovibrio alaskensis (strain G20) GN=argH PE=3 SV=1 2 456 1.0E-121
sp|Q8ELT9|ARLY_OCEIH Argininosuccinate lyase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argH PE=3 SV=1 2 459 1.0E-121
sp|B1JQ59|ARLY_YERPY Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=argH PE=3 SV=1 2 448 1.0E-121
sp|A1AX52|ARLY_RUTMC Argininosuccinate lyase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argH PE=3 SV=1 3 456 2.0E-121
sp|Q1WV66|ARLY_LACS1 Argininosuccinate lyase OS=Lactobacillus salivarius (strain UCC118) GN=argH PE=3 SV=1 2 457 2.0E-121
sp|B2V6Y7|ARLY_SULSY Argininosuccinate lyase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=argH PE=3 SV=1 2 449 2.0E-121
sp|Q7VME5|ARLY_HAEDU Argininosuccinate lyase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argH PE=3 SV=1 2 455 2.0E-121
sp|B1X082|ARLY_CYAA5 Argininosuccinate lyase OS=Cyanothece sp. (strain ATCC 51142) GN=argH PE=3 SV=1 3 458 2.0E-121
sp|B8EPF2|ARLY_METSB Argininosuccinate lyase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=argH PE=3 SV=1 2 447 3.0E-121
sp|Q9Z660|ARLY_ZYMMO Argininosuccinate lyase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=argH PE=3 SV=2 2 448 3.0E-121
sp|Q169X5|ARLY_ROSDO Argininosuccinate lyase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=argH PE=3 SV=1 2 455 3.0E-121
sp|A4WG51|ARLY_ENT38 Argininosuccinate lyase OS=Enterobacter sp. (strain 638) GN=argH PE=3 SV=1 2 448 4.0E-121
sp|A1VZR4|ARLY_CAMJJ Argininosuccinate lyase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=argH PE=3 SV=1 2 456 5.0E-121
sp|Q5WED9|ARLY2_BACSK Argininosuccinate lyase 2 OS=Bacillus clausii (strain KSM-K16) GN=argH2 PE=3 SV=1 2 458 5.0E-121
sp|Q2LT96|ARLY_SYNAS Argininosuccinate lyase OS=Syntrophus aciditrophicus (strain SB) GN=argH PE=3 SV=1 3 453 5.0E-121
sp|Q66G70|ARLY_YERPS Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argH PE=3 SV=1 2 448 9.0E-121
sp|B2JZE4|ARLY_YERPB Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=argH PE=3 SV=1 2 448 9.0E-121
sp|Q5KW95|ARLY_GEOKA Argininosuccinate lyase OS=Geobacillus kaustophilus (strain HTA426) GN=argH PE=3 SV=2 2 455 1.0E-120
sp|B2TQ24|ARLY_CLOBB Argininosuccinate lyase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=argH PE=3 SV=1 2 459 1.0E-120
sp|B7GGR5|ARLY_ANOFW Argininosuccinate lyase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=argH PE=3 SV=1 2 456 1.0E-120
sp|B2UYI1|ARLY_CLOBA Argininosuccinate lyase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=argH PE=3 SV=1 2 463 1.0E-120
sp|A4TRH3|ARLY_YERPP Argininosuccinate lyase OS=Yersinia pestis (strain Pestoides F) GN=argH PE=3 SV=1 2 448 1.0E-120
sp|Q1CNQ3|ARLY_YERPN Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=argH PE=3 SV=1 2 448 1.0E-120
sp|A9R514|ARLY_YERPG Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=argH PE=3 SV=1 2 448 1.0E-120
sp|Q8ZA88|ARLY_YERPE Argininosuccinate lyase OS=Yersinia pestis GN=argH PE=3 SV=1 2 448 1.0E-120
sp|Q1CBV4|ARLY_YERPA Argininosuccinate lyase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=argH PE=3 SV=1 2 448 1.0E-120
sp|A7FD01|ARLY_YERP3 Argininosuccinate lyase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argH PE=3 SV=1 2 448 1.0E-120
sp|B8F531|ARLY_HAEPS Argininosuccinate lyase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=argH PE=3 SV=1 2 455 1.0E-120
sp|B9MRP4|ARLY_CALBD Argininosuccinate lyase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=argH PE=3 SV=1 2 459 2.0E-120
sp|Q2G4W0|ARLY_NOVAD Argininosuccinate lyase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=argH PE=3 SV=1 2 461 2.0E-120
sp|A1JI24|ARLY_YERE8 Argininosuccinate lyase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=argH PE=3 SV=1 2 448 2.0E-120
sp|B7K8U6|ARLY_CYAP7 Argininosuccinate lyase OS=Cyanothece sp. (strain PCC 7424) GN=argH PE=3 SV=1 3 456 2.0E-120
sp|A0AKJ8|ARLY_LISW6 Argininosuccinate lyase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=argH PE=3 SV=1 2 439 2.0E-120
sp|B8I1A0|ARLY_CLOCE Argininosuccinate lyase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=argH PE=3 SV=1 2 455 2.0E-120
sp|Q3A9W6|ARLY_CARHZ Argininosuccinate lyase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argH PE=3 SV=1 2 455 3.0E-120
sp|Q2SQ67|ARLY_HAHCH Argininosuccinate lyase OS=Hahella chejuensis (strain KCTC 2396) GN=argH PE=3 SV=1 2 456 3.0E-120
sp|A8FLY0|ARLY_CAMJ8 Argininosuccinate lyase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=argH PE=3 SV=1 2 456 3.0E-120
sp|Q72GZ4|ARLY_THET2 Argininosuccinate lyase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argH PE=3 SV=1 3 449 6.0E-120
sp|Q9K821|ARLY_BACHD Argininosuccinate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argH PE=3 SV=1 2 455 6.0E-120
sp|A0KFV4|ARLY_AERHH Argininosuccinate lyase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=argH PE=3 SV=1 2 444 6.0E-120
sp|A4SIM6|ARLY_AERS4 Argininosuccinate lyase OS=Aeromonas salmonicida (strain A449) GN=argH PE=3 SV=1 2 441 6.0E-120
sp|Q30S87|ARLY_SULDN Argininosuccinate lyase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=argH PE=3 SV=1 2 456 7.0E-120
sp|B8CNI1|ARLY_SHEPW Argininosuccinate lyase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=argH PE=3 SV=1 2 440 8.0E-120
sp|B1M509|ARLY_METRJ Argininosuccinate lyase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=argH PE=3 SV=1 2 449 9.0E-120
sp|B1ZKR9|ARLY_METPB Argininosuccinate lyase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=argH PE=3 SV=1 2 449 9.0E-120
sp|Q9K3D7|ARGHA_MORPR Bifunctional protein ArgHA (Fragment) OS=Moritella profunda GN=argHA PE=3 SV=1 2 440 9.0E-120
sp|A5VAA0|ARLY_SPHWW Argininosuccinate lyase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=argH PE=3 SV=1 2 448 9.0E-120
sp|Q5E2E8|ARLY_VIBF1 Bifunctional protein ArgH OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argH PE=3 SV=1 2 449 1.0E-119
sp|Q0A574|ARLY_ALKEH Argininosuccinate lyase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=argH PE=3 SV=1 2 457 1.0E-119
sp|Q5SLL0|ARLY_THET8 Argininosuccinate lyase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argH PE=1 SV=1 3 449 1.0E-119
sp|C3LRV2|ARLY_VIBCM Argininosuccinate lyase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=argH PE=3 SV=1 2 456 2.0E-119
sp|Q9KNT9|ARLY_VIBCH Argininosuccinate lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argH PE=3 SV=1 2 456 2.0E-119
sp|A5F4Z3|ARLY_VIBC3 Argininosuccinate lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=argH PE=3 SV=1 2 456 2.0E-119
sp|Q7MH73|ARLY_VIBVY Bifunctional protein ArgH OS=Vibrio vulnificus (strain YJ016) GN=argH PE=3 SV=1 2 449 2.0E-119
sp|Q8DCM9|ARLY_VIBVU Bifunctional protein ArgH OS=Vibrio vulnificus (strain CMCP6) GN=argH PE=3 SV=1 2 449 2.0E-119
sp|O67383|ARLY_AQUAE Argininosuccinate lyase OS=Aquifex aeolicus (strain VF5) GN=argH PE=3 SV=1 3 452 2.0E-119
sp|B2VGA9|ARLY_ERWT9 Argininosuccinate lyase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argH PE=3 SV=1 2 448 2.0E-119
sp|P59617|ARLY_LACPL Argininosuccinate lyase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argH PE=3 SV=1 2 449 3.0E-119
sp|A9W714|ARLY_METEP Argininosuccinate lyase OS=Methylobacterium extorquens (strain PA1) GN=argH PE=3 SV=1 2 447 4.0E-119
sp|B7KW75|ARLY_METC4 Argininosuccinate lyase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=argH PE=3 SV=1 2 449 5.0E-119
sp|A0Q1Z1|ARLY_CLONN Argininosuccinate lyase OS=Clostridium novyi (strain NT) GN=argH PE=3 SV=1 2 432 5.0E-119
sp|Q7MYD9|ARLY_PHOLL Argininosuccinate lyase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argH PE=3 SV=1 2 458 7.0E-119
sp|A9IZG7|ARLY_BART1 Argininosuccinate lyase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=argH PE=3 SV=1 2 448 1.0E-118
sp|Q3ASM4|ARLY_CHLCH Argininosuccinate lyase OS=Chlorobium chlorochromatii (strain CaD3) GN=argH PE=3 SV=1 1 453 1.0E-118
sp|P59620|ARLY_VIBPA Bifunctional protein ArgH OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argH PE=3 SV=1 2 445 1.0E-118
sp|C4L7S8|ARLY_TOLAT Argininosuccinate lyase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=argH PE=3 SV=1 2 448 1.0E-118
sp|Q2JXY9|ARLY_SYNJA Argininosuccinate lyase OS=Synechococcus sp. (strain JA-3-3Ab) GN=argH PE=3 SV=1 3 449 1.0E-118
sp|A3DBU0|ARLY_CLOTH Argininosuccinate lyase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=argH PE=3 SV=1 2 449 1.0E-118
sp|B0CEZ5|ARLY_ACAM1 Argininosuccinate lyase OS=Acaryochloris marina (strain MBIC 11017) GN=argH PE=3 SV=1 2 459 2.0E-118
sp|P57159|ARLY_BUCAI Argininosuccinate lyase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argH PE=3 SV=1 2 448 2.0E-118
sp|B0TL84|ARLY_SHEHH Argininosuccinate lyase OS=Shewanella halifaxensis (strain HAW-EB4) GN=argH PE=3 SV=1 2 440 2.0E-118
sp|P73257|ARLY_SYNY3 Argininosuccinate lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argH PE=3 SV=1 3 450 4.0E-118
sp|Q9LAE5|ARLY_NOSP7 Argininosuccinate lyase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argH PE=3 SV=2 3 439 5.0E-118
sp|B2G6Y7|ARLY_LACRJ Argininosuccinate lyase OS=Lactobacillus reuteri (strain JCM 1112) GN=argH PE=3 SV=1 2 456 5.0E-118
sp|A5VJH2|ARLY_LACRD Argininosuccinate lyase OS=Lactobacillus reuteri (strain DSM 20016) GN=argH PE=3 SV=1 2 456 5.0E-118
sp|Q97KE5|ARLY_CLOAB Argininosuccinate lyase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argH PE=3 SV=1 2 436 5.0E-118
sp|B8FH31|ARLY_DESAA Argininosuccinate lyase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=argH PE=3 SV=1 3 462 6.0E-118
sp|A8AUN7|ARLY_STRGC Argininosuccinate lyase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=argH PE=3 SV=1 2 449 6.0E-118
sp|A7IG40|ARLY_XANP2 Argininosuccinate lyase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=argH PE=3 SV=1 2 449 7.0E-118
sp|A8GZ22|ARLY_SHEPA Argininosuccinate lyase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=argH PE=3 SV=1 2 444 9.0E-118
sp|C1DJ48|ARLY_AZOVD Argininosuccinate lyase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=argH PE=3 SV=1 3 455 1.0E-117
sp|Q12SM6|ARLY_SHEDO Argininosuccinate lyase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=argH PE=3 SV=1 2 450 1.0E-117
sp|B9DVV8|ARLY_STRU0 Argininosuccinate lyase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=argH PE=3 SV=1 2 452 2.0E-117
sp|A1RPR5|ARLY_SHESW Argininosuccinate lyase OS=Shewanella sp. (strain W3-18-1) GN=argH PE=3 SV=1 2 448 2.0E-117
sp|Q3SUR0|ARLY_NITWN Argininosuccinate lyase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=argH PE=3 SV=1 2 449 2.0E-117
sp|Q82TN0|ARLY_NITEU Argininosuccinate lyase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argH PE=3 SV=1 3 455 3.0E-117
sp|Q033U6|ARLY_LACC3 Argininosuccinate lyase OS=Lactobacillus casei (strain ATCC 334) GN=argH PE=3 SV=1 2 455 3.0E-117
sp|Q5LXC0|ARLY_RUEPO Argininosuccinate lyase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=argH PE=3 SV=1 2 455 3.0E-117
sp|B4S7P9|ARLY_PROA2 Argininosuccinate lyase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=argH PE=3 SV=1 1 448 3.0E-117
sp|Q1QHU1|ARLY_NITHX Argininosuccinate lyase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=argH PE=3 SV=1 2 447 3.0E-117
sp|C4Z0V2|ARLY_EUBE2 Argininosuccinate lyase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=argH PE=3 SV=1 2 438 3.0E-117
sp|A3CQQ3|ARLY_STRSV Argininosuccinate lyase OS=Streptococcus sanguinis (strain SK36) GN=argH PE=3 SV=1 2 449 3.0E-117
sp|Q7VVG6|ARLY_BORPE Argininosuccinate lyase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argH PE=3 SV=1 3 449 4.0E-117
sp|Q7WAE4|ARLY_BORPA Argininosuccinate lyase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argH PE=3 SV=2 3 449 4.0E-117
sp|Q7WJI7|ARLY_BORBR Argininosuccinate lyase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argH PE=3 SV=1 3 449 4.0E-117
sp|Q2RXE3|ARLY_RHORT Argininosuccinate lyase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=argH PE=3 SV=1 2 444 4.0E-117
sp|A3PMB7|ARLY_RHOS1 Argininosuccinate lyase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argH PE=3 SV=1 2 455 4.0E-117
sp|A2BZB5|ARLY_PROM1 Argininosuccinate lyase OS=Prochlorococcus marinus (strain NATL1A) GN=argH PE=3 SV=1 3 455 5.0E-117
sp|Q46I50|ARLY_PROMT Argininosuccinate lyase OS=Prochlorococcus marinus (strain NATL2A) GN=argH PE=3 SV=1 3 455 6.0E-117
sp|A9KTY6|ARLY_SHEB9 Argininosuccinate lyase OS=Shewanella baltica (strain OS195) GN=argH PE=3 SV=1 2 448 7.0E-117
sp|A3DA22|ARLY_SHEB5 Argininosuccinate lyase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=argH PE=3 SV=1 2 448 8.0E-117
sp|A4WVB9|ARLY_RHOS5 Argininosuccinate lyase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=argH PE=3 SV=1 2 455 8.0E-117
sp|A9B9L0|ARLY_PROM4 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9211) GN=argH PE=3 SV=1 3 449 8.0E-117
sp|B0JXI2|ARLY_MICAN Argininosuccinate lyase OS=Microcystis aeruginosa (strain NIES-843) GN=argH PE=3 SV=1 3 439 8.0E-117
sp|A4YBT8|ARLY_SHEPC Argininosuccinate lyase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=argH PE=3 SV=1 2 448 9.0E-117
sp|Q3MC57|ARLY_ANAVT Argininosuccinate lyase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argH PE=3 SV=1 3 453 1.0E-116
sp|Q8YQE6|ARLY_NOSS1 Argininosuccinate lyase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argH PE=3 SV=1 3 452 1.0E-116
sp|Q3IZY2|ARLY_RHOS4 Argininosuccinate lyase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argH PE=3 SV=1 2 455 2.0E-116
sp|A4XKG3|ARLY_CALS8 Argininosuccinate lyase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=argH PE=3 SV=1 2 456 2.0E-116
sp|Q48QD3|ARLY_PSE14 Argininosuccinate lyase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=argH PE=3 SV=1 3 444 3.0E-116
sp|A2RHL0|ARLY_LACLM Argininosuccinate lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=argH PE=3 SV=1 2 456 3.0E-116
sp|Q88B94|ARLY_PSESM Argininosuccinate lyase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argH PE=3 SV=1 3 455 4.0E-116
sp|B4U6T9|ARLY_HYDS0 Argininosuccinate lyase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=argH PE=3 SV=1 3 450 4.0E-116
sp|Q8KA59|ARLY_BUCAP Argininosuccinate lyase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argH PE=3 SV=1 2 448 5.0E-116
sp|Q13CL5|ARLY_RHOPS Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain BisB5) GN=argH PE=3 SV=1 2 449 5.0E-116
sp|Q20WT9|ARLY_RHOPB Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain BisB18) GN=argH PE=3 SV=2 2 449 5.0E-116
sp|Q479S1|ARLY_DECAR Argininosuccinate lyase OS=Dechloromonas aromatica (strain RCB) GN=argH PE=3 SV=1 3 440 6.0E-116
sp|Q47N85|ARLY_THEFY Argininosuccinate lyase OS=Thermobifida fusca (strain YX) GN=argH PE=3 SV=1 2 455 6.0E-116
sp|Q2VYN2|ARLY_MAGSA Argininosuccinate lyase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=argH PE=3 SV=1 2 448 6.0E-116
sp|A9KQ51|ARLY_CLOPH Argininosuccinate lyase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=argH PE=3 SV=1 2 449 7.0E-116
sp|C3K426|ARLY_PSEFS Argininosuccinate lyase OS=Pseudomonas fluorescens (strain SBW25) GN=argH PE=3 SV=1 3 448 8.0E-116
sp|P59614|ARLY_BUCBP Argininosuccinate lyase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=argH PE=3 SV=1 2 457 8.0E-116
sp|B8GSV2|ARLY_THISH Argininosuccinate lyase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=argH PE=3 SV=1 2 444 9.0E-116
sp|Q28V48|ARLY_JANSC Argininosuccinate lyase OS=Jannaschia sp. (strain CCS1) GN=argH PE=3 SV=1 2 455 1.0E-115
sp|Q03W71|ARLY_LEUMM Argininosuccinate lyase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=argH PE=3 SV=1 2 448 1.0E-115
sp|Q5FPK5|ARLY_GLUOX Argininosuccinate lyase OS=Gluconobacter oxydans (strain 621H) GN=argH PE=3 SV=1 3 447 1.0E-115
sp|A4XNY5|ARLY_PSEMY Argininosuccinate lyase OS=Pseudomonas mendocina (strain ymp) GN=argH PE=3 SV=1 3 455 1.0E-115
sp|Q1GXA9|ARLY_METFK Argininosuccinate lyase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=argH PE=3 SV=1 3 455 2.0E-115
sp|Q7VFF8|ARLY_HELHP Argininosuccinate lyase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=argH PE=3 SV=1 2 456 2.0E-115
sp|Q2L1J6|ARLY_BORA1 Argininosuccinate lyase OS=Bordetella avium (strain 197N) GN=argH PE=3 SV=1 3 449 2.0E-115
sp|Q500N3|ARLY_PSEU2 Argininosuccinate lyase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=argH PE=3 SV=1 3 444 2.0E-115
sp|Q7VEK0|ARLY_PROMA Argininosuccinate lyase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argH PE=3 SV=1 3 455 2.0E-115
sp|Q0AGL1|ARLY_NITEC Argininosuccinate lyase OS=Nitrosomonas eutropha (strain C91) GN=argH PE=3 SV=1 3 455 3.0E-115
sp|Q3ZYF9|ARLY_DEHMC Argininosuccinate lyase OS=Dehalococcoides mccartyi (strain CBDB1) GN=argH PE=3 SV=1 5 455 3.0E-115
sp|A5FQ74|ARLY_DEHMB Argininosuccinate lyase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=argH PE=3 SV=1 5 455 3.0E-115
sp|Q9K3D6|ARGHA_MORAB Bifunctional protein ArgHA OS=Moritella abyssi GN=argHA PE=3 SV=1 2 440 4.0E-115
sp|B3QCB2|ARLY_RHOPT Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain TIE-1) GN=argH PE=3 SV=1 2 449 4.0E-115
sp|Q6N0L9|ARLY_RHOPA Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=argH PE=3 SV=1 2 449 4.0E-115
sp|Q8DLW0|ARLY_THEEB Argininosuccinate lyase OS=Thermosynechococcus elongatus (strain BP-1) GN=argH PE=3 SV=1 3 455 4.0E-115
sp|Q49W99|ARLY_STAS1 Argininosuccinate lyase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=argH PE=3 SV=1 3 455 5.0E-115
sp|Q5P7H3|ARLY_AROAE Argininosuccinate lyase OS=Aromatoleum aromaticum (strain EbN1) GN=argH PE=3 SV=1 3 452 6.0E-115
sp|Q9CJ76|ARLY_LACLA Argininosuccinate lyase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argH PE=3 SV=1 2 457 7.0E-115
sp|Q4JVZ7|ARLY_CORJK Argininosuccinate lyase OS=Corynebacterium jeikeium (strain K411) GN=argH PE=3 SV=1 2 447 8.0E-115
sp|C6DI79|ARLY_PECCP Argininosuccinate lyase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=argH PE=3 SV=1 2 448 9.0E-115
sp|Q3B426|ARLY_CHLL7 Argininosuccinate lyase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=argH PE=3 SV=1 1 455 9.0E-115
sp|A5N6U3|ARLY_CLOK5 Argininosuccinate lyase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=argH PE=3 SV=1 2 432 9.0E-115
sp|B9E0B2|ARLY_CLOK1 Argininosuccinate lyase OS=Clostridium kluyveri (strain NBRC 12016) GN=argH PE=3 SV=1 2 432 9.0E-115
sp|P59613|ARLY_BRADU Argininosuccinate lyase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argH PE=3 SV=1 2 449 9.0E-115
sp|B1J1V0|ARLY_PSEPW Argininosuccinate lyase OS=Pseudomonas putida (strain W619) GN=argH PE=3 SV=1 3 444 9.0E-115
sp|Q03IP9|ARLY_STRTD Argininosuccinate lyase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=argH PE=3 SV=1 2 449 1.0E-114
sp|Q5M2K3|ARLY_STRT2 Argininosuccinate lyase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=argH PE=3 SV=2 2 449 1.0E-114
sp|Q5LXZ9|ARLY_STRT1 Argininosuccinate lyase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=argH PE=3 SV=2 2 449 1.0E-114
sp|Q2JJY4|ARLY_SYNJB Argininosuccinate lyase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=argH PE=3 SV=1 3 449 1.0E-114
sp|Q8E271|ARLY_STRA5 Argininosuccinate lyase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=argH PE=3 SV=1 2 456 1.0E-114
sp|P59618|ARLY_PSEPK Argininosuccinate lyase OS=Pseudomonas putida (strain KT2440) GN=argH PE=3 SV=2 3 444 1.0E-114
sp|Q5HBZ4|ARLY_EHRRW Argininosuccinate lyase OS=Ehrlichia ruminantium (strain Welgevonden) GN=argH PE=3 SV=1 2 449 1.0E-114
sp|B0KH03|ARLY_PSEPG Argininosuccinate lyase OS=Pseudomonas putida (strain GB-1) GN=argH PE=3 SV=1 3 444 2.0E-114
sp|Q3K4S8|ARLY2_PSEPF Argininosuccinate lyase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=argH2 PE=3 SV=1 3 448 2.0E-114
sp|Q182I5|ARLY_PEPD6 Argininosuccinate lyase OS=Peptoclostridium difficile (strain 630) GN=argH PE=3 SV=2 2 432 2.0E-114
sp|A2SET3|ARLY_METPP Argininosuccinate lyase OS=Methylibium petroleiphilum (strain PM1) GN=argH PE=3 SV=1 3 455 2.0E-114
sp|Q0AM30|ARLY_MARMM Argininosuccinate lyase OS=Maricaulis maris (strain MCS10) GN=argH PE=3 SV=1 2 455 2.0E-114
sp|Q1I314|ARLY_PSEE4 Argininosuccinate lyase OS=Pseudomonas entomophila (strain L48) GN=argH PE=3 SV=1 3 444 2.0E-114
sp|Q8E7N0|ARLY_STRA3 Argininosuccinate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=argH PE=3 SV=1 2 456 2.0E-114
sp|Q032X5|ARLY_LACLS Argininosuccinate lyase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=argH PE=3 SV=1 2 456 3.0E-114
sp|A6VE40|ARLY_PSEA7 Argininosuccinate lyase OS=Pseudomonas aeruginosa (strain PA7) GN=argH PE=3 SV=1 3 455 3.0E-114
sp|Q5FH83|ARLY_EHRRG Argininosuccinate lyase OS=Ehrlichia ruminantium (strain Gardel) GN=argH PE=3 SV=1 2 449 4.0E-114
sp|Q8DVX5|ARLY_STRMU Argininosuccinate lyase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argH PE=3 SV=1 2 448 4.0E-114
sp|Q02EA0|ARLY_PSEAB Argininosuccinate lyase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argH PE=3 SV=1 3 455 4.0E-114
sp|B8EBF9|ARLY_SHEB2 Argininosuccinate lyase OS=Shewanella baltica (strain OS223) GN=argH PE=3 SV=1 2 448 4.0E-114
sp|A1S265|ARLY_SHEAM Argininosuccinate lyase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=argH PE=3 SV=1 2 440 5.0E-114
sp|Q5FA15|ARLY_NEIG1 Argininosuccinate lyase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argH PE=3 SV=1 3 454 5.0E-114
sp|A4VGX6|ARLY_PSEU5 Argininosuccinate lyase OS=Pseudomonas stutzeri (strain A1501) GN=argH PE=3 SV=1 3 449 5.0E-114
sp|B7V5F3|ARLY_PSEA8 Argininosuccinate lyase OS=Pseudomonas aeruginosa (strain LESB58) GN=argH PE=3 SV=1 3 455 5.0E-114
sp|Q4K3X1|ARLY_PSEF5 Argininosuccinate lyase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=argH PE=3 SV=1 3 444 5.0E-114
sp|P50987|ARLY_PSEAE Argininosuccinate lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argH PE=3 SV=2 3 455 5.0E-114
sp|Q6DAQ9|ARLY_PECAS Argininosuccinate lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argH PE=3 SV=1 2 448 7.0E-114
sp|B1MZP3|ARLY_LEUCK Argininosuccinate lyase OS=Leuconostoc citreum (strain KM20) GN=argH PE=3 SV=1 2 448 7.0E-114
sp|A0LE33|ARLY_MAGMM Argininosuccinate lyase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=argH PE=3 SV=1 2 457 7.0E-114
sp|A4VXZ3|ARLY_STRSY Argininosuccinate lyase OS=Streptococcus suis (strain 05ZYH33) GN=argH PE=3 SV=1 2 459 7.0E-114
sp|A4W487|ARLY_STRS2 Argininosuccinate lyase OS=Streptococcus suis (strain 98HAH33) GN=argH PE=3 SV=1 2 459 7.0E-114
sp|Q9JVG7|ARLY_NEIMA Argininosuccinate lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argH PE=3 SV=1 3 454 8.0E-114
sp|Q8GIS1|ARLY_SYNE7 Argininosuccinate lyase OS=Synechococcus elongatus (strain PCC 7942) GN=argH PE=3 SV=1 3 458 9.0E-114
sp|Q3YSS4|ARLY_EHRCJ Argininosuccinate lyase OS=Ehrlichia canis (strain Jake) GN=argH PE=3 SV=1 2 449 1.0E-113
sp|B9EAN2|ARLY_MACCJ Argininosuccinate lyase OS=Macrococcus caseolyticus (strain JCSC5402) GN=argH PE=3 SV=1 2 448 1.0E-113
sp|Q3K3Q3|ARLY_STRA1 Argininosuccinate lyase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=argH PE=3 SV=1 2 456 1.0E-113
sp|Q3Z726|ARLY_DEHM1 Argininosuccinate lyase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=argH PE=3 SV=1 6 455 1.0E-113
sp|B7GTN9|ARLY_BIFLS Argininosuccinate lyase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=argH PE=3 SV=1 2 448 2.0E-113
sp|A5EB50|ARLY_BRASB Argininosuccinate lyase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=argH PE=3 SV=1 2 449 2.0E-113
sp|A8G1A3|ARLY_SHESH Argininosuccinate lyase OS=Shewanella sediminis (strain HAW-EB3) GN=argH PE=3 SV=1 2 440 2.0E-113
sp|Q0SI59|ARLY_RHOJR Argininosuccinate lyase OS=Rhodococcus jostii (strain RHA1) GN=argH PE=3 SV=1 2 454 2.0E-113
sp|Q8KDJ5|ARLY_CHLTE Argininosuccinate lyase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argH PE=3 SV=1 1 448 2.0E-113
sp|A1KSP4|ARLY_NEIMF Argininosuccinate lyase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argH PE=3 SV=1 3 455 2.0E-113
sp|Q9K0G8|ARLY_NEIMB Argininosuccinate lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argH PE=3 SV=1 3 455 2.0E-113
sp|A9M2R4|ARLY_NEIM0 Argininosuccinate lyase OS=Neisseria meningitidis serogroup C (strain 053442) GN=argH PE=3 SV=1 3 455 2.0E-113
sp|A6WTR9|ARLY_SHEB8 Argininosuccinate lyase OS=Shewanella baltica (strain OS185) GN=argH PE=3 SV=1 2 448 2.0E-113
sp|A1K451|ARLY_AZOSB Argininosuccinate lyase OS=Azoarcus sp. (strain BH72) GN=argH PE=3 SV=1 3 455 3.0E-113
sp|B1Y070|ARLY_LEPCP Argininosuccinate lyase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=argH PE=3 SV=1 3 449 4.0E-113
sp|Q2GFQ7|ARLY_EHRCR Argininosuccinate lyase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=argH PE=3 SV=1 2 449 4.0E-113
sp|C1ASZ5|ARLY_RHOOB Argininosuccinate lyase OS=Rhodococcus opacus (strain B4) GN=argH PE=3 SV=1 2 454 5.0E-113
sp|Q2J1X2|ARLY_RHOP2 Argininosuccinate lyase OS=Rhodopseudomonas palustris (strain HaA2) GN=argH PE=3 SV=1 2 449 5.0E-113
sp|Q5N1K1|ARLY_SYNP6 Argininosuccinate lyase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argH PE=3 SV=1 3 458 6.0E-113
sp|B8ILR2|ARLY_METNO Argininosuccinate lyase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=argH PE=3 SV=1 2 447 7.0E-113
sp|Q0VM25|ARLY_ALCBS Argininosuccinate lyase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=argH PE=3 SV=1 2 440 8.0E-113
sp|Q8G5F3|ARLY_BIFLO Argininosuccinate lyase OS=Bifidobacterium longum (strain NCC 2705) GN=argH PE=3 SV=1 2 448 1.0E-112
sp|B3DSY6|ARLY_BIFLD Argininosuccinate lyase OS=Bifidobacterium longum (strain DJO10A) GN=argH PE=3 SV=1 2 448 1.0E-112
sp|A8LL46|ARLY_DINSH Argininosuccinate lyase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=argH PE=3 SV=1 2 455 1.0E-112
sp|A9HRH6|ARLY_GLUDA Argininosuccinate lyase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=argH PE=3 SV=1 3 447 2.0E-112
sp|B1IK07|ARLY_CLOBK Argininosuccinate lyase OS=Clostridium botulinum (strain Okra / Type B1) GN=argH PE=3 SV=1 2 432 2.0E-112
sp|B4S9T4|ARLY_PELPB Argininosuccinate lyase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=argH PE=3 SV=1 1 455 2.0E-112
sp|Q024T3|ARLY_SOLUE Argininosuccinate lyase OS=Solibacter usitatus (strain Ellin6076) GN=argH PE=3 SV=1 2 455 4.0E-112
sp|Q31DH2|ARLY_PROM9 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9312) GN=argH PE=3 SV=1 2 448 4.0E-112
sp|B9DIU3|ARLY_STACT Argininosuccinate lyase OS=Staphylococcus carnosus (strain TM300) GN=argH PE=3 SV=1 3 455 5.0E-112
sp|Q4L4X6|ARLY_STAHJ Argininosuccinate lyase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=argH PE=3 SV=1 3 455 7.0E-112
sp|A1WB09|ARLY_ACISJ Argininosuccinate lyase OS=Acidovorax sp. (strain JS42) GN=argH PE=3 SV=1 3 455 7.0E-112
sp|B9MDU0|ARLY_ACIET Argininosuccinate lyase OS=Acidovorax ebreus (strain TPSY) GN=argH PE=3 SV=1 3 455 7.0E-112
sp|A0LEB1|ARLY_SYNFM Argininosuccinate lyase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=argH PE=3 SV=1 2 461 7.0E-112
sp|A7GGQ8|ARLY_CLOBL Argininosuccinate lyase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=argH PE=3 SV=1 2 432 1.0E-111
sp|A4Z1S4|ARLY_BRASO Argininosuccinate lyase OS=Bradyrhizobium sp. (strain ORS278) GN=argH PE=3 SV=1 2 449 1.0E-111
sp|B2GE78|ARLY_LACF3 Argininosuccinate lyase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=argH PE=3 SV=1 2 455 1.0E-111
sp|Q1LJQ2|ARLY_CUPMC Argininosuccinate lyase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=argH PE=3 SV=1 3 444 1.0E-111
sp|C4L2P3|ARLY_EXISA Argininosuccinate lyase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=argH PE=3 SV=1 2 449 2.0E-111
sp|Q1IWM5|ARLY_DEIGD Argininosuccinate lyase OS=Deinococcus geothermalis (strain DSM 11300) GN=argH PE=3 SV=1 2 455 2.0E-111
sp|Q6GIC8|ARLY_STAAR Argininosuccinate lyase OS=Staphylococcus aureus (strain MRSA252) GN=argH PE=3 SV=1 3 455 2.0E-111
sp|P63583|ARLY_STAAN Argininosuccinate lyase OS=Staphylococcus aureus (strain N315) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|P63582|ARLY_STAAM Argininosuccinate lyase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|A6QFH1|ARLY_STAAE Argininosuccinate lyase OS=Staphylococcus aureus (strain Newman) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|Q5HHC5|ARLY_STAAC Argininosuccinate lyase OS=Staphylococcus aureus (strain COL) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|A5IRD8|ARLY_STAA9 Argininosuccinate lyase OS=Staphylococcus aureus (strain JH9) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|Q2FZU2|ARLY_STAA8 Argininosuccinate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|A6U067|ARLY_STAA2 Argininosuccinate lyase OS=Staphylococcus aureus (strain JH1) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|A7X0H4|ARLY_STAA1 Argininosuccinate lyase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|Q7TTY1|ARLY_SYNPX Argininosuccinate lyase OS=Synechococcus sp. (strain WH8102) GN=argH PE=3 SV=1 3 458 3.0E-111
sp|A5FWI3|ARLY_ACICJ Argininosuccinate lyase OS=Acidiphilium cryptum (strain JF-5) GN=argH PE=3 SV=1 3 445 3.0E-111
sp|Q2YWS5|ARLY_STAAB Argininosuccinate lyase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=argH PE=3 SV=1 3 455 3.0E-111
sp|P59616|ARLY_CLOTE Argininosuccinate lyase OS=Clostridium tetani (strain Massachusetts / E88) GN=argH PE=3 SV=1 2 432 4.0E-111
sp|Q9A683|ARLY_CAUCR Argininosuccinate lyase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argH PE=3 SV=2 2 455 4.0E-111
sp|Q8NXF3|ARLY_STAAW Argininosuccinate lyase OS=Staphylococcus aureus (strain MW2) GN=argH PE=3 SV=1 3 455 4.0E-111
sp|Q6GAW6|ARLY_STAAS Argininosuccinate lyase OS=Staphylococcus aureus (strain MSSA476) GN=argH PE=3 SV=1 3 455 4.0E-111
sp|Q7TUI1|ARLY_PROMP Argininosuccinate lyase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argH PE=3 SV=1 2 439 1.0E-110
sp|A4G3U8|ARLY_HERAR Argininosuccinate lyase OS=Herminiimonas arsenicoxydans GN=argH PE=3 SV=1 3 455 1.0E-110
sp|B0T2T7|ARLY_CAUSK Argininosuccinate lyase OS=Caulobacter sp. (strain K31) GN=argH PE=3 SV=1 2 455 1.0E-110
sp|C1D665|ARLY_LARHH Argininosuccinate lyase OS=Laribacter hongkongensis (strain HLHK9) GN=argH PE=3 SV=1 3 455 1.0E-110
sp|Q6FFB2|ARLY_ACIAD Argininosuccinate lyase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=argH PE=3 SV=1 2 456 2.0E-110
sp|C3L1U2|ARLY_CLOB6 Argininosuccinate lyase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=argH PE=3 SV=1 2 432 2.0E-110
sp|A8Z066|ARLY_STAAT Argininosuccinate lyase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=argH PE=3 SV=1 3 455 2.0E-110
sp|Q2FIB5|ARLY_STAA3 Argininosuccinate lyase OS=Staphylococcus aureus (strain USA300) GN=argH PE=3 SV=1 3 455 2.0E-110
sp|B1KP64|ARLY_SHEWM Argininosuccinate lyase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=argH PE=3 SV=1 2 440 2.0E-110
sp|C5CRT0|ARLY_VARPS Argininosuccinate lyase OS=Variovorax paradoxus (strain S110) GN=argH PE=3 SV=1 3 448 2.0E-110
sp|Q6A816|ARLY_PROAC Argininosuccinate lyase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=argH PE=3 SV=2 2 455 2.0E-110
sp|Q0HDU9|ARLY_SHESM Argininosuccinate lyase OS=Shewanella sp. (strain MR-4) GN=argH PE=3 SV=1 2 448 3.0E-110
sp|Q9L1B1|ARLY_STRCO Argininosuccinate lyase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argH PE=3 SV=1 2 452 3.0E-110
sp|Q8EK27|ARLY_SHEON Argininosuccinate lyase OS=Shewanella oneidensis (strain MR-1) GN=argH PE=3 SV=1 2 448 3.0E-110
sp|Q1QEM4|ARLY_PSYCK Argininosuccinate lyase OS=Psychrobacter cryohalolentis (strain K5) GN=argH PE=3 SV=1 2 457 4.0E-110
sp|A4QDZ5|ARLY_CORGB Argininosuccinate lyase OS=Corynebacterium glutamicum (strain R) GN=argH PE=3 SV=1 2 447 4.0E-110
sp|A0L250|ARLY_SHESA Argininosuccinate lyase OS=Shewanella sp. (strain ANA-3) GN=argH PE=3 SV=1 2 449 4.0E-110
sp|A4FKC1|ARLY_SACEN Argininosuccinate lyase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=argH PE=3 SV=1 2 447 5.0E-110
sp|A2C5K9|ARLY_PROM3 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9303) GN=argH PE=3 SV=1 3 455 6.0E-110
sp|C1FU67|ARLY_CLOBJ Argininosuccinate lyase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=argH PE=3 SV=1 2 432 6.0E-110
sp|Q143B9|ARLY_BURXL Argininosuccinate lyase OS=Burkholderia xenovorans (strain LB400) GN=argH PE=3 SV=1 3 456 7.0E-110
sp|Q0I060|ARLY_SHESR Argininosuccinate lyase OS=Shewanella sp. (strain MR-7) GN=argH PE=3 SV=1 2 448 7.0E-110
sp|B3QN90|ARLY_CHLP8 Argininosuccinate lyase OS=Chlorobaculum parvum (strain NCIB 8327) GN=argH PE=3 SV=1 1 452 9.0E-110
sp|Q7TV86|ARLY_PROMM Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9313) GN=argH PE=3 SV=1 3 455 9.0E-110
sp|P59615|ARLY_BURM1 Argininosuccinate lyase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=argH PE=3 SV=1 3 444 9.0E-110
sp|Q6NHG4|ARLY_CORDI Argininosuccinate lyase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argH PE=3 SV=1 2 447 1.0E-109
sp|A8ESF7|ARLY_ARCB4 Argininosuccinate lyase OS=Arcobacter butzleri (strain RM4018) GN=argH PE=3 SV=1 18 456 1.0E-109
sp|Q21EF4|ARLY_SACD2 Argininosuccinate lyase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=argH PE=3 SV=1 3 444 1.0E-109
sp|Q4FVJ6|ARLY_PSYA2 Argininosuccinate lyase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=argH PE=3 SV=1 2 457 1.0E-109
sp|Q6AGC8|ARLY_LEIXX Argininosuccinate lyase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=argH PE=3 SV=1 2 451 2.0E-109
sp|A5I5A3|ARLY_CLOBH Argininosuccinate lyase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=argH PE=3 SV=1 2 432 2.0E-109
sp|A7FWU5|ARLY_CLOB1 Argininosuccinate lyase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=argH PE=3 SV=1 2 432 2.0E-109
sp|Q8FTM8|ARLY_COREF Argininosuccinate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argH PE=3 SV=1 2 447 2.0E-109
sp|O88101|ARLY_CORGL Argininosuccinate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argH PE=3 SV=2 2 447 2.0E-109
sp|Q8CT81|ARLY_STAES Argininosuccinate lyase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argH PE=3 SV=1 3 456 2.0E-109
sp|Q5HQK1|ARLY_STAEQ Argininosuccinate lyase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argH PE=3 SV=1 3 456 2.0E-109
sp|Q3ANN7|ARLY_SYNSC Argininosuccinate lyase OS=Synechococcus sp. (strain CC9605) GN=argH PE=3 SV=1 3 449 2.0E-109
sp|A2BTV0|ARLY_PROM5 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9515) GN=argH PE=3 SV=1 2 439 4.0E-109
sp|B1KXY0|ARLY_CLOBM Argininosuccinate lyase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=argH PE=3 SV=1 2 432 4.0E-109
sp|Q0IE70|ARLY_SYNS3 Argininosuccinate lyase OS=Synechococcus sp. (strain CC9311) GN=argH PE=3 SV=1 3 450 5.0E-109
sp|Q39DW2|ARLY_BURL3 Argininosuccinate lyase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=argH PE=3 SV=1 3 440 5.0E-109
sp|Q3JDS2|ARLY_NITOC Argininosuccinate lyase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=argH PE=3 SV=1 3 456 8.0E-109
sp|A4SWK9|ARLY_POLSQ Argininosuccinate lyase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=argH PE=3 SV=1 3 452 1.0E-108
sp|Q2T079|ARLY_BURTA Argininosuccinate lyase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=argH PE=3 SV=1 3 444 1.0E-108
sp|Q2Y6K2|ARLY_NITMU Argininosuccinate lyase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=argH PE=3 SV=1 3 458 1.0E-108
sp|A4JGV8|ARLY_BURVG Argininosuccinate lyase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=argH PE=3 SV=1 3 444 1.0E-108
sp|A5GHM4|ARLY_SYNPW Argininosuccinate lyase OS=Synechococcus sp. (strain WH7803) GN=argH PE=3 SV=1 3 459 2.0E-108
sp|Q827Z0|ARLY_STRAW Argininosuccinate lyase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argH PE=3 SV=1 2 452 2.0E-108
sp|A0K9K2|ARLY_BURCH Argininosuccinate lyase OS=Burkholderia cenocepacia (strain HI2424) GN=argH PE=3 SV=1 3 440 2.0E-108
sp|Q1BUI4|ARLY_BURCA Argininosuccinate lyase OS=Burkholderia cenocepacia (strain AU 1054) GN=argH PE=3 SV=1 3 440 2.0E-108
sp|B0VDE4|ARLY_ACIBY Argininosuccinate lyase OS=Acinetobacter baumannii (strain AYE) GN=argH PE=3 SV=1 2 448 2.0E-108
sp|B7I338|ARLY_ACIB5 Argininosuccinate lyase OS=Acinetobacter baumannii (strain AB0057) GN=argH PE=3 SV=1 2 448 2.0E-108
sp|B7H1L9|ARLY_ACIB3 Argininosuccinate lyase OS=Acinetobacter baumannii (strain AB307-0294) GN=argH PE=3 SV=1 2 448 2.0E-108
sp|B1W3B4|ARLY_STRGG Argininosuccinate lyase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=argH PE=3 SV=1 2 455 2.0E-108
sp|Q6AR60|ARLY_DESPS Argininosuccinate lyase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argH PE=3 SV=1 2 450 2.0E-108
sp|A1V5V1|ARLY_BURMS Argininosuccinate lyase OS=Burkholderia mallei (strain SAVP1) GN=argH PE=3 SV=1 3 444 3.0E-108
sp|Q62LD1|ARLY_BURMA Argininosuccinate lyase OS=Burkholderia mallei (strain ATCC 23344) GN=argH PE=3 SV=1 3 444 3.0E-108
sp|A2SAG6|ARLY_BURM9 Argininosuccinate lyase OS=Burkholderia mallei (strain NCTC 10229) GN=argH PE=3 SV=1 3 444 3.0E-108
sp|A3MLL6|ARLY_BURM7 Argininosuccinate lyase OS=Burkholderia mallei (strain NCTC 10247) GN=argH PE=3 SV=1 3 444 3.0E-108
sp|A3M1E0|ARLY_ACIBT Argininosuccinate lyase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=argH PE=3 SV=2 2 448 3.0E-108
sp|B0VMC7|ARLY_ACIBS Argininosuccinate lyase OS=Acinetobacter baumannii (strain SDF) GN=argH PE=3 SV=1 2 448 3.0E-108
sp|B2I1W9|ARLY_ACIBC Argininosuccinate lyase OS=Acinetobacter baumannii (strain ACICU) GN=argH PE=3 SV=1 2 448 3.0E-108
sp|B0UJ26|ARLY_METS4 Argininosuccinate lyase OS=Methylobacterium sp. (strain 4-46) GN=argH PE=3 SV=1 2 449 3.0E-108
sp|B1JWR5|ARLY_BURCC Argininosuccinate lyase OS=Burkholderia cenocepacia (strain MC0-3) GN=argH PE=3 SV=1 3 440 3.0E-108
sp|B4E8D2|ARLY_BURCJ Argininosuccinate lyase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=argH PE=3 SV=1 3 440 4.0E-108
sp|Q2J867|ARLY_FRASC Argininosuccinate lyase OS=Frankia sp. (strain CcI3) GN=argH PE=3 SV=1 2 455 4.0E-108
sp|A9WQ91|ARLY_RENSM Argininosuccinate lyase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=argH PE=3 SV=1 2 447 5.0E-108
sp|Q7NLS0|ARLY_GLOVI Argininosuccinate lyase OS=Gloeobacter violaceus (strain PCC 7421) GN=argH PE=3 SV=1 3 439 5.0E-108
sp|Q31JG7|ARLY_THICR Argininosuccinate lyase OS=Thiomicrospira crunogena (strain XCL-2) GN=argH PE=3 SV=1 2 455 7.0E-108
sp|Q1QSV4|ARLY_CHRSD Argininosuccinate lyase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=argH PE=3 SV=1 3 444 8.0E-108
sp|Q609I6|ARLY_METCA Argininosuccinate lyase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argH PE=3 SV=1 2 444 1.0E-107
sp|Q3SM68|ARLY_THIDA Argininosuccinate lyase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=argH PE=3 SV=1 3 442 2.0E-107
sp|B2UA10|ARLY_RALPJ Argininosuccinate lyase OS=Ralstonia pickettii (strain 12J) GN=argH PE=3 SV=1 3 449 2.0E-107
sp|A6Q7P5|ARLY_SULNB Argininosuccinate lyase OS=Sulfurovum sp. (strain NBC37-1) GN=argH PE=3 SV=1 2 456 2.0E-107
sp|A1SJJ4|ARLY_NOCSJ Argininosuccinate lyase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=argH PE=3 SV=1 2 455 2.0E-107
sp|A1TNJ5|ARLY_ACIAC Argininosuccinate lyase OS=Acidovorax citrulli (strain AAC00-1) GN=argH PE=3 SV=1 3 455 2.0E-107
sp|A8G1Z9|ARLY_PROM2 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9215) GN=argH PE=3 SV=1 2 439 2.0E-107
sp|B2JEP3|ARLY_BURP8 Argininosuccinate lyase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=argH PE=3 SV=1 3 444 3.0E-107
sp|A6SX31|ARLY_JANMA Argininosuccinate lyase OS=Janthinobacterium sp. (strain Marseille) GN=argH PE=3 SV=1 3 455 3.0E-107
sp|C1CXS0|ARLY_DEIDV Argininosuccinate lyase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=argH PE=3 SV=1 2 455 3.0E-107
sp|B2T1C7|ARLY_BURPP Argininosuccinate lyase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=argH PE=3 SV=1 3 440 4.0E-107
sp|A1WVT8|ARLY_HALHL Argininosuccinate lyase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=argH PE=3 SV=1 2 455 4.0E-107
sp|Q8XWV7|ARLY_RALSO Argininosuccinate lyase OS=Ralstonia solanacearum (strain GMI1000) GN=argH PE=3 SV=1 3 450 5.0E-107
sp|A3PA59|ARLY_PROM0 Argininosuccinate lyase OS=Prochlorococcus marinus (strain MIT 9301) GN=argH PE=3 SV=1 2 449 6.0E-107
sp|B1XVG9|ARLY_POLNS Argininosuccinate lyase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=argH PE=3 SV=1 3 449 6.0E-107
sp|A3Q9D0|ARLY_SHELP Argininosuccinate lyase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=argH PE=3 SV=1 2 444 1.0E-106
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3546
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3137
Ophiocordyceps australis map64 (Brazil) OphauB2|2309
Ophiocordyceps camponoti-floridani Ophcf2|05608
Ophiocordyceps camponoti-rufipedis Ophun1|4782 (this protein)
Ophiocordyceps kimflemingae Ophio5|3039
Ophiocordyceps subramaniannii Hirsu2|68

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4782
MLWGGRFTGGLDPLMVRYNESINFDRALYEQDIRGSIAFARANADAGIITGTEFRQIEEGLLKVLQEWETNAFVI
VPGVDEDIHTANERRLGELIGKHVAGKLHTGRSRNEQVVCDMRMWLRDELRAIERHLIDLLTVLADRAEGEMHLI
MPGYTHLQRAQPIRWSHWLLSYGLVFADDLQRLREVIRRVNRSPLGCGALAGNPFGIDRDKMRRELGFDDLLWNS
MGGVADRDFVTETLQWGAMLMQHISRWAEDLIVYSTTEFGFVRLADAYSTGSSLMPQKKNPDSLELLRGKSGRAF
GQMAGFMMTQKGLPSTYNKDLQESVEPMLDQIKTVADSIQIANGVLSTLKTNGDRMRAALDPFMLATDVADYLVR
KGVPFRETHHISGRCVAKSEETGIPMNELSFEQLKAIDNRFDEDVAQVFDYDASIERRSAKGGTSKSGVAEQIKM
LRDMLKMSKRSDVVGVYV*
Coding >Ophun1|4782
ATGCTCTGGGGAGGGCGCTTCACAGGTGGCCTTGATCCCCTCATGGTGCGATACAACGAGAGCATCAACTTCGAT
CGTGCACTCTACGAGCAAGACATCCGCGGAAGCATCGCCTTCGCCAGAGCCAACGCCGACGCCGGCATCATCACC
GGAACCGAGTTCCGTCAGATCGAAGAGGGCCTGCTCAAGGTTCTGCAGGAGTGGGAGACGAACGCTTTCGTCATT
GTCCCAGGCGTCGACGAAGACATCCACACGGCCAACGAGCGCCGTCTCGGAGAGCTCATTGGCAAGCACGTCGCT
GGCAAGCTTCACACGGGCCGTAGTCGCAATGAGCAGGTCGTGTGTGACATGCGCATGTGGCTGCGCGATGAGCTG
CGTGCTATTGAGCGCCATCTGATCGACCTGCTCACCGTCTTGGCCGACCGTGCCGAGGGCGAGATGCATCTCATC
ATGCCCGGCTACACCCACTTGCAGCGCGCCCAGCCCATCCGCTGGAGCCATTGGCTGCTATCGTACGGCCTGGTC
TTTGCGGACGACCTGCAGCGCCTGCGCGAGGTTATTCGCCGCGTCAACAGGAGCCCTCTAGGCTGCGGAGCCCTG
GCCGGCAACCCGTTCGGAATCGACCGCGACAAGATGAGGCGCGAGCTGGGATTCGATGACCTGCTTTGGAACTCG
ATGGGCGGCGTGGCCGACCGCGACTTCGTGACCGAGACGCTGCAGTGGGGGGCCATGTTGATGCAACACATCTCT
CGCTGGGCTGAGGACCTGATTGTGTACTCGACGACCGAGTTCGGCTTCGTCCGCCTCGCCGACGCCTACTCGACG
GGAAGCTCTCTGATGCCGCAGAAGAAGAATCCGGACAGTCTGGAGCTGCTGCGCGGCAAGAGCGGGCGCGCCTTT
GGGCAGATGGCCGGCTTCATGATGACGCAAAAGGGCCTCCCGAGCACCTACAACAAGGACCTGCAAGAGAGCGTC
GAGCCCATGCTGGACCAGATCAAGACGGTGGCCGACAGCATCCAGATTGCCAACGGCGTCTTGTCGACGCTCAAG
ACCAACGGCGACCGGATGCGAGCCGCGCTGGACCCCTTTATGCTCGCGACCGACGTGGCCGACTACCTGGTGCGC
AAGGGCGTGCCGTTCCGCGAGACTCATCACATCTCGGGGCGCTGCGTGGCCAAATCGGAGGAGACGGGTATCCCG
ATGAACGAGCTGTCATTTGAGCAGCTCAAGGCCATCGACAACAGGTTCGACGAGGACGTGGCCCAGGTGTTTGAC
TATGACGCCAGCATCGAGCGCCGGTCGGCCAAGGGGGGAACGAGCAAGTCTGGCGTCGCGGAGCAGATCAAGATG
CTGAGGGACATGTTGAAGATGAGCAAGAGGTCGGACGTTGTTGGTGTGTATGTATGA
Transcript >Ophun1|4782
ATGCTCTGGGGAGGGCGCTTCACAGGTGGCCTTGATCCCCTCATGGTGCGATACAACGAGAGCATCAACTTCGAT
CGTGCACTCTACGAGCAAGACATCCGCGGAAGCATCGCCTTCGCCAGAGCCAACGCCGACGCCGGCATCATCACC
GGAACCGAGTTCCGTCAGATCGAAGAGGGCCTGCTCAAGGTTCTGCAGGAGTGGGAGACGAACGCTTTCGTCATT
GTCCCAGGCGTCGACGAAGACATCCACACGGCCAACGAGCGCCGTCTCGGAGAGCTCATTGGCAAGCACGTCGCT
GGCAAGCTTCACACGGGCCGTAGTCGCAATGAGCAGGTCGTGTGTGACATGCGCATGTGGCTGCGCGATGAGCTG
CGTGCTATTGAGCGCCATCTGATCGACCTGCTCACCGTCTTGGCCGACCGTGCCGAGGGCGAGATGCATCTCATC
ATGCCCGGCTACACCCACTTGCAGCGCGCCCAGCCCATCCGCTGGAGCCATTGGCTGCTATCGTACGGCCTGGTC
TTTGCGGACGACCTGCAGCGCCTGCGCGAGGTTATTCGCCGCGTCAACAGGAGCCCTCTAGGCTGCGGAGCCCTG
GCCGGCAACCCGTTCGGAATCGACCGCGACAAGATGAGGCGCGAGCTGGGATTCGATGACCTGCTTTGGAACTCG
ATGGGCGGCGTGGCCGACCGCGACTTCGTGACCGAGACGCTGCAGTGGGGGGCCATGTTGATGCAACACATCTCT
CGCTGGGCTGAGGACCTGATTGTGTACTCGACGACCGAGTTCGGCTTCGTCCGCCTCGCCGACGCCTACTCGACG
GGAAGCTCTCTGATGCCGCAGAAGAAGAATCCGGACAGTCTGGAGCTGCTGCGCGGCAAGAGCGGGCGCGCCTTT
GGGCAGATGGCCGGCTTCATGATGACGCAAAAGGGCCTCCCGAGCACCTACAACAAGGACCTGCAAGAGAGCGTC
GAGCCCATGCTGGACCAGATCAAGACGGTGGCCGACAGCATCCAGATTGCCAACGGCGTCTTGTCGACGCTCAAG
ACCAACGGCGACCGGATGCGAGCCGCGCTGGACCCCTTTATGCTCGCGACCGACGTGGCCGACTACCTGGTGCGC
AAGGGCGTGCCGTTCCGCGAGACTCATCACATCTCGGGGCGCTGCGTGGCCAAATCGGAGGAGACGGGTATCCCG
ATGAACGAGCTGTCATTTGAGCAGCTCAAGGCCATCGACAACAGGTTCGACGAGGACGTGGCCCAGGTGTTTGAC
TATGACGCCAGCATCGAGCGCCGGTCGGCCAAGGGGGGAACGAGCAAGTCTGGCGTCGCGGAGCAGATCAAGATG
CTGAGGGACATGTTGAAGATGAGCAAGAGGTCGGACGTTGTTGGTGTGTATGTATGA
Gene >Ophun1|4782
ATGCTCTGGGGAGGGCGCTTCACAGGTATGTAGCCATGTCCAGATATTCATAGTGACGGCGTCTGACCATCAAAC
ATCGCAGGTGGCCTTGATCCCCTCATGGTGCGATACAACGAGAGCATCAACTTCGATCGTGCACTCTACGAGCAA
GACATCCGCGGAAGCATCGCCTTCGCCAGAGCCAACGCCGACGCCGGCATCATCACCGGAACCGAGTTCCGTCAG
ATCGAAGAGGGCCTGCTCAAGGTTCTGCAGGAGTGGGAGACGAACGCTTTCGTCATTGTCCCAGGCGTCGACGAA
GACATCCACACGGCCAACGAGCGCCGTCTCGGAGAGCTCATTGGCAAGCACGTCGCTGGCAAGCTTCACACGGGC
CGTAGTCGCAATGAGCAGGTCGTGTGTGACATGCGCATGTGGCTGCGCGATGAGCTGCGTGCTATTGAGCGCCAT
CTGATCGACCTGCTCACCGTCTTGGCCGACCGTGCCGAGGGCGAGATGCATCTCATCATGCCCGGCTACACCCAC
TTGCAGCGCGCCCAGCCCATCCGCTGGAGCCATTGGCTGCTATCGTACGGCCTGGTCTTTGCGGACGACCTGCAG
CGCCTGCGCGAGGTTATTCGCCGCGTCAACAGGAGCCCTCTAGGCTGCGGAGCCCTGGCCGGCAACCCGTTCGGA
ATCGACCGCGACAAGATGAGGCGCGAGCTGGGATTCGATGACCTGCTTTGGAACTCGATGGGCGGCGTGGCCGAC
CGCGACTTCGTGACCGAGACGCTGCAGTGGGGGGCCATGTTGATGCAACACATCTCTCGCTGGGCTGAGGACCTG
ATTGTGTACTCGACGACCGAGTTCGGCTTCGTCCGCCTCGCCGACGCCTACTCGACGGGAAGCTCTCTGATGCCG
CAGAAGAAGAATCCGGACAGTCTGGAGCTGCTGCGCGGCAAGAGCGGGCGCGCCTTTGGGCAGATGGCCGGCTTC
ATGATGACGCAAAAGGGCCTCCCGAGCACCTACAACAAGGACCTGCAAGAGAGCGTCGAGCCCATGCTGGACCAG
ATCAAGACGGTGGCCGACAGCATCCAGATTGCCAACGGCGTCTTGTCGACGCTCAAGACCAACGGCGACCGGATG
CGAGCCGCGCTGGACCCCTTTATGCTCGCGACCGACGTGGCCGACTACCTGGTGCGCAAGGGCGTGCCGTTCCGC
GAGACTCATCACATCTCGGGGCGCTGCGTGGCCAAATCGGAGGAGACGGGTATCCCGATGAACGAGCTGTCATTT
GAGCAGCTCAAGGCCATCGACAACAGGTTCGACGAGGACGTGGCCCAGGTGTTTGACTATGACGCCAGCATCGAG
CGCCGGTCGGCCAAGGGGGGAACGAGCAAGTCTGGCGTCGCGGAGCAGATCAAGATGCTGAGGGACATGTTGAAG
ATGAGCAAGAGGTCGGACGTTGTTGGTGTGTATGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail