Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4779
Gene name
LocationContig_449:13497..14652
Strand+
Gene length (bp)1155
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00887 ACBP Acyl CoA binding protein 3.0E-20 103 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O01805|ACBP1_CAEEL Acyl-CoA-binding protein homolog 1 OS=Caenorhabditis elegans GN=acbp-1 PE=3 SV=1 100 187 1.0E-15
sp|P31824|ACBP_MANSE Acyl-CoA-binding protein homolog OS=Manduca sexta PE=3 SV=1 104 187 1.0E-14
sp|P42281|ACBP_DROME Acyl-CoA-binding protein homolog OS=Drosophila melanogaster GN=Dbi PE=2 SV=1 99 184 2.0E-14
sp|Q9PRL8|ACBP_CHICK Acyl-CoA-binding protein OS=Gallus gallus GN=DBI PE=1 SV=1 103 187 1.0E-12
sp|Q9Y7Z3|ACBP_SCHPO Putative acyl-CoA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.06 PE=3 SV=1 100 187 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O01805|ACBP1_CAEEL Acyl-CoA-binding protein homolog 1 OS=Caenorhabditis elegans GN=acbp-1 PE=3 SV=1 100 187 1.0E-15
sp|P31824|ACBP_MANSE Acyl-CoA-binding protein homolog OS=Manduca sexta PE=3 SV=1 104 187 1.0E-14
sp|P42281|ACBP_DROME Acyl-CoA-binding protein homolog OS=Drosophila melanogaster GN=Dbi PE=2 SV=1 99 184 2.0E-14
sp|Q9PRL8|ACBP_CHICK Acyl-CoA-binding protein OS=Gallus gallus GN=DBI PE=1 SV=1 103 187 1.0E-12
sp|Q9Y7Z3|ACBP_SCHPO Putative acyl-CoA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.06 PE=3 SV=1 100 187 2.0E-12
sp|Q9TQX6|ACBP_CANLF Acyl-CoA-binding protein OS=Canis lupus familiaris GN=DBI PE=1 SV=2 99 187 8.0E-12
sp|Q5FXM5|ACBP_DICDI Acyl-CoA-binding protein OS=Dictyostelium discoideum GN=acbA PE=1 SV=1 104 182 1.0E-11
sp|P12026|ACBP_PIG Acyl-CoA-binding protein OS=Sus scrofa GN=DBI PE=1 SV=2 99 187 1.0E-11
sp|Q8WN94|ACBP_RABIT Acyl-CoA-binding protein OS=Oryctolagus cuniculus GN=DBI PE=3 SV=3 99 187 2.0E-11
sp|P82934|ACBP_CHAVI Acyl-CoA-binding protein OS=Chaetophractus villosus GN=DBI PE=1 SV=2 99 187 4.0E-11
sp|P31787|ACBP_YEAST Acyl-CoA-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACB1 PE=1 SV=3 99 184 5.0E-11
sp|Q39315|ACBP_BRANA Acyl-CoA-binding protein OS=Brassica napus PE=3 SV=1 104 182 1.0E-10
sp|P45883|ACBP_PELRI Acyl-CoA-binding protein homolog OS=Pelophylax ridibundus PE=1 SV=2 104 181 1.0E-10
sp|P07108|ACBP_HUMAN Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE=1 SV=2 99 187 2.0E-10
sp|P07107|ACBP_BOVIN Acyl-CoA-binding protein OS=Bos taurus GN=DBI PE=1 SV=2 99 187 2.0E-10
sp|P11030|ACBP_RAT Acyl-CoA-binding protein OS=Rattus norvegicus GN=Dbi PE=1 SV=3 99 187 7.0E-10
sp|P31786|ACBP_MOUSE Acyl-CoA-binding protein OS=Mus musculus GN=Dbi PE=1 SV=2 99 187 9.0E-10
sp|P61867|ACBP2_SACPS Acyl-CoA-binding protein 2 OS=Saccharomyces pastorianus GN=ACB2 PE=1 SV=2 99 184 2.0E-09
sp|Q8N6N7|ACBD7_HUMAN Acyl-CoA-binding domain-containing protein 7 OS=Homo sapiens GN=ACBD7 PE=1 SV=1 104 181 2.0E-09
sp|P61868|ACBP2_SACMO Acyl-CoA-binding protein 2 OS=Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525) GN=ACB2 PE=3 SV=2 99 184 2.0E-09
sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 104 182 3.0E-09
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 104 185 4.0E-09
sp|Q39779|ACBP_GOSHI Acyl-CoA-binding protein OS=Gossypium hirsutum PE=3 SV=1 104 187 5.0E-09
sp|Q9D258|ACBD7_MOUSE Acyl-CoA-binding domain-containing protein 7 OS=Mus musculus GN=Acbd7 PE=3 SV=2 104 181 6.0E-09
sp|P57752|ACBP6_ARATH Acyl-CoA-binding domain-containing protein 6 OS=Arabidopsis thaliana GN=ACBP6 PE=1 SV=1 104 182 9.0E-09
sp|P45882|ACBP_ANAPL Acyl-CoA-binding protein OS=Anas platyrhynchos GN=DBI PE=3 SV=1 104 181 1.0E-08
sp|Q3SZF0|ACBD7_BOVIN Acyl-CoA-binding domain-containing protein 7 OS=Bos taurus GN=ACBD7 PE=3 SV=1 104 181 2.0E-08
sp|P0C8L7|ACBP_HYPDU Putative acyl-CoA-binding protein OS=Hypsibius dujardini PE=3 SV=1 104 187 3.0E-08
sp|Q4V869|ACBD6_XENLA Acyl-CoA-binding domain-containing protein 6 OS=Xenopus laevis GN=acbd6 PE=2 SV=1 92 197 2.0E-07
sp|Q66JD7|ACBD6_XENTR Acyl-CoA-binding domain-containing protein 6 OS=Xenopus tropicalis GN=acbd6 PE=2 SV=1 104 197 3.0E-07
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 104 179 5.0E-07
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 104 179 5.0E-07
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 73 176 6.0E-07
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 113 182 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000062 fatty-acyl-CoA binding Yes
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0033218 amide binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:1901567 fatty acid derivative binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0120227 acyl-CoA binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901681 sulfur compound binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.997121

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4849
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2397
Ophiocordyceps australis map64 (Brazil) OphauB2|2695
Ophiocordyceps camponoti-floridani Ophcf2|04073
Ophiocordyceps camponoti-rufipedis Ophun1|4779 (this protein)
Ophiocordyceps kimflemingae Ophio5|5430
Ophiocordyceps subramaniannii Hirsu2|10915

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4779
MKAAVLALAISTAAALPRGTSFFAGTFRSPSISTAGPVSSPGSSTDGPARSPENGSERNAAATNAQRGVMRREAT
KTGAVQREATRTADASKETQHPVMCSPAFEKAVVDSKKLTSKPSNDDLLQLYALYKVGIGEDVAKSPDPGMFDLK
GKAKKKAWQAVADEGISPEAAQEKYVALVEKLKASCGYDENKAPEAVGQS*
Coding >Ophun1|4779
ATGAAAGCCGCCGTCCTCGCCCTCGCCATCTCCACGGCAGCAGCCCTCCCCAGGGGAACAAGCTTCTTCGCAGGG
ACCTTTCGCTCTCCGTCAATCAGCACTGCAGGGCCGGTGAGCTCCCCGGGCAGCAGCACCGACGGGCCGGCGCGC
TCTCCGGAGAATGGCAGCGAAAGGAATGCGGCGGCGACGAATGCGCAGAGGGGAGTTATGCGGCGTGAAGCTACG
AAGACGGGGGCTGTGCAGAGAGAGGCTACGAGGACGGCGGACGCGTCCAAGGAGACTCAACACCCGGTCATGTGC
AGTCCAGCCTTCGAGAAAGCCGTCGTCGACAGCAAGAAGTTGACGAGCAAACCCAGCAACGACGACCTGCTGCAG
CTGTACGCGCTCTACAAGGTCGGCATCGGTGAGGACGTGGCCAAGAGTCCTGATCCAGGCATGTTCGACCTCAAG
GGAAAAGCCAAGAAGAAGGCGTGGCAGGCCGTGGCGGACGAGGGCATCAGCCCGGAAGCCGCGCAGGAGAAATAC
GTCGCGCTGGTTGAGAAGCTCAAGGCTTCGTGCGGCTATGATGAGAACAAGGCGCCCGAAGCGGTGGGGCAGTCG
TGA
Transcript >Ophun1|4779
ATGAAAGCCGCCGTCCTCGCCCTCGCCATCTCCACGGCAGCAGCCCTCCCCAGGGGAACAAGCTTCTTCGCAGGG
ACCTTTCGCTCTCCGTCAATCAGCACTGCAGGGCCGGTGAGCTCCCCGGGCAGCAGCACCGACGGGCCGGCGCGC
TCTCCGGAGAATGGCAGCGAAAGGAATGCGGCGGCGACGAATGCGCAGAGGGGAGTTATGCGGCGTGAAGCTACG
AAGACGGGGGCTGTGCAGAGAGAGGCTACGAGGACGGCGGACGCGTCCAAGGAGACTCAACACCCGGTCATGTGC
AGTCCAGCCTTCGAGAAAGCCGTCGTCGACAGCAAGAAGTTGACGAGCAAACCCAGCAACGACGACCTGCTGCAG
CTGTACGCGCTCTACAAGGTCGGCATCGGTGAGGACGTGGCCAAGAGTCCTGATCCAGGCATGTTCGACCTCAAG
GGAAAAGCCAAGAAGAAGGCGTGGCAGGCCGTGGCGGACGAGGGCATCAGCCCGGAAGCCGCGCAGGAGAAATAC
GTCGCGCTGGTTGAGAAGCTCAAGGCTTCGTGCGGCTATGATGAGAACAAGGCGCCCGAAGCGGTGGGGCAGTCG
TGA
Gene >Ophun1|4779
ATGAAAGCCGCCGTCCTCGCCCTCGCCATCTCCACGGCAGCAGCCCTCCCCAGGGGAACAAGCTTCTTCGCAGGG
ACCTTTCGCTCTCCGTCAATCAGCACTGCAGGGCCGGTGAGCTCCCCGGGCAGCAGCACCGACGGGCCGGCGCGC
TCTCCGGAGAATGGCAGCGAAAGGAATGCGGCGGCGACGAATGCGCAGAGGGGAGTTATGCGGCGTGAAGCTACG
AAGACGGGGGCTGTGCAGAGAGAGGCTACGAGGACGGCGGACGCGTCCAAGGAGACTCAACACCCGGTCATGTGC
GTGAGTGGGTTTAGTGGGAATACGCCGACTTGCTACTGGAGAGGGTGAGGTTGATAGAGGAGGAGAGGGAGACGA
GGAGAGAAGCTGAGAACAGGTAAAGATAGGTACCTATGTGGGAGTGGAACAGCGGGTTGAGTCTAGGTTATTGCC
CACAGAGGTCTTCAAGCACGAATAGCGCCTGTCTTGTAGCCGAGCCCGTGTGGGAGTGAAACAGCGGGTGAAGTC
TAGGTTCTTACCGACCTGGTTCCCAAGCACGAACCATCCATCCATCCCACCAGCATCCGATGACCGCACGTGACC
AAACCCCTCCATTTAACCCCTCCCGATCCCATGACAGCTCTCCCTCTCCAAACCCCCGATCATCTGGCAGAAGCA
GAAGCAGCAGCAGCAAGAATGGCGCCCGCCCAGAGTCCAGCCTTCGAGAAAGCCGTCGTCGACAGCAAGAAGTTG
ACGAGCAAACCCAGCAACGACGACCTGCTGCAGCTGTACGGTGAGCAGACTCGGCCGCGGAGGAGTTTTGCGTCC
TAGAAAGACTGACGGCTTGACGACGGGTAGCGCTCTACAAGGTCGGCATCGGTGAGGACGTGGCCAAGAGTCCTG
ATCCAGGCATGTTCGACCTCAAGGTATCGTCTTCACCCACCCCCCCACCACCACCATGACGCAACCCAGCTCGAG
AAGCTGACCGAGGGGGAAACACAACAGGGAAAAGCCAAGAAGAAGGCGTGGCAGGCCGTGGCGGACGAGGGCATC
AGCCCGGAAGCCGCGCAGGAGAAATACGTCGCGCTGGTTGAGAAGCTCAAGGCTTCGTGCGGCTATGATGAGAAC
AAGGCGCCCGAAGCGGTGGGGCAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail