Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4778
Gene name
LocationContig_449:12166..13123
Strand+
Gene length (bp)957
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.1E-07 15 78
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.1E-06 163 225

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 1 235 1.0E-07

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1419
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3990
Ophiocordyceps australis map64 (Brazil) OphauB2|5967
Ophiocordyceps camponoti-floridani Ophcf2|04074
Ophiocordyceps camponoti-rufipedis Ophun1|4778 (this protein)
Ophiocordyceps kimflemingae Ophio5|5428
Ophiocordyceps subramaniannii Hirsu2|10914

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4778
MATGPDDAIRAGRRIYLGNLPYTVKPYDVEELLVANGFDQCIDNIHISIDPVSARNPGYCFVDFVDRDTAERALA
DLKAEISNRPLKVGPCQPKRSGGARDDSSFERWGDWRGKADDGRAGGYTSRASQQGPHGALDHFDDIVSNHEGRR
VFLGGLRPMVDQAQNHREVREIFADFNPTAIGKRITPRAETRREPGNHHYCFVDFKTRTEAASAIKALNGKPVPG
GSLTVALARGIPEKLLTRHFDAEPEAAFRRPRQATPTTGPSKAMASTDWRRAADG*
Coding >Ophun1|4778
ATGGCTACCGGGCCTGACGATGCCATCAGGGCAGGCCGACGTATCTATCTAGGCAACCTCCCGTATACAGTAAAG
CCATACGACGTGGAGGAACTGCTAGTAGCCAATGGCTTCGATCAATGCATCGACAACATCCATATCTCCATCGAC
CCCGTCAGCGCCAGAAACCCCGGTTACTGCTTCGTCGATTTCGTGGACCGCGATACAGCCGAACGCGCCCTCGCC
GACCTGAAAGCGGAGATTAGCAACCGGCCCCTCAAGGTCGGACCGTGTCAGCCCAAGAGATCCGGCGGGGCGCGC
GATGACAGCTCCTTTGAGCGATGGGGGGACTGGCGCGGCAAGGCCGATGATGGCAGGGCTGGAGGATATACTTCC
CGCGCGTCTCAGCAGGGTCCTCACGGTGCGCTCGATCACTTTGACGATATTGTTAGCAACCATGAGGGCAGGAGA
GTGTTCTTGGGGGGGCTTCGGCCGATGGTGGATCAGGCGCAGAACCACCGCGAGGTCAGGGAAATATTCGCCGAT
TTTAACCCCACCGCCATCGGAAAGCGCATCACGCCCCGTGCAGAAACGAGACGGGAGCCGGGAAATCACCATTAC
TGCTTCGTCGACTTCAAGACGCGCACCGAAGCCGCCTCGGCCATCAAAGCCCTGAACGGCAAGCCCGTCCCCGGA
GGCTCTCTCACGGTGGCCCTCGCACGCGGCATCCCGGAAAAGCTGCTGACGCGGCATTTCGACGCCGAGCCCGAG
GCTGCTTTCCGTCGACCTCGACAGGCGACGCCTACGACGGGACCGAGCAAGGCCATGGCGTCTACCGACTGGCGC
CGTGCTGCTGATGGGTAA
Transcript >Ophun1|4778
ATGGCTACCGGGCCTGACGATGCCATCAGGGCAGGCCGACGTATCTATCTAGGCAACCTCCCGTATACAGTAAAG
CCATACGACGTGGAGGAACTGCTAGTAGCCAATGGCTTCGATCAATGCATCGACAACATCCATATCTCCATCGAC
CCCGTCAGCGCCAGAAACCCCGGTTACTGCTTCGTCGATTTCGTGGACCGCGATACAGCCGAACGCGCCCTCGCC
GACCTGAAAGCGGAGATTAGCAACCGGCCCCTCAAGGTCGGACCGTGTCAGCCCAAGAGATCCGGCGGGGCGCGC
GATGACAGCTCCTTTGAGCGATGGGGGGACTGGCGCGGCAAGGCCGATGATGGCAGGGCTGGAGGATATACTTCC
CGCGCGTCTCAGCAGGGTCCTCACGGTGCGCTCGATCACTTTGACGATATTGTTAGCAACCATGAGGGCAGGAGA
GTGTTCTTGGGGGGGCTTCGGCCGATGGTGGATCAGGCGCAGAACCACCGCGAGGTCAGGGAAATATTCGCCGAT
TTTAACCCCACCGCCATCGGAAAGCGCATCACGCCCCGTGCAGAAACGAGACGGGAGCCGGGAAATCACCATTAC
TGCTTCGTCGACTTCAAGACGCGCACCGAAGCCGCCTCGGCCATCAAAGCCCTGAACGGCAAGCCCGTCCCCGGA
GGCTCTCTCACGGTGGCCCTCGCACGCGGCATCCCGGAAAAGCTGCTGACGCGGCATTTCGACGCCGAGCCCGAG
GCTGCTTTCCGTCGACCTCGACAGGCGACGCCTACGACGGGACCGAGCAAGGCCATGGCGTCTACCGACTGGCGC
CGTGCTGCTGATGGGTAA
Gene >Ophun1|4778
ATGGCTACCGGGCCTGACGATGCCATCAGGGCAGGCCGACGTATCTATCTAGGTTCGTTCCAGCTGTCCTACCCT
CTCAAACGCCCACTGACGCGTCAAGACAGGCAACCTCCCGTATACAGTAAAGCCATACGACGTGGAGGAACTGCT
AGTAGCCAATGGCTTCGATCAATGCATCGACAACATCCATATCTCCATCGACCCCGTCAGCGCCAGAAACCCCGG
TTACTGCTTCGTCGATTTCGTGGACCGCGATACAGCCGAACGCGCCCTCGCCGACCTGAAAGCGGAGATTAGCAA
CCGGCCCCTCAAGGTCGGACCGTGTCAGCCCAAGAGATCCGGCGGGGCGCGCGATGACAGCTCCTTTGAGCGATG
GGGGGACTGGCGCGGCAAGGCCGATGATGGCAGGGCTGGAGGATATACTTCCCGCGCGTCTCAGCAGGGTCCTCA
CGGTGCGCTCGATCACTTTGACGATATTGTTAGCAACCATGAGGGCAGGAGAGTGTTCTTGGGGGGGCTTCGGCC
GATGGTGGATCAGGCGCAGAACCACCGCGAGGTCAGGGAAATATTCGCCGATTTTAACCCGTACGTGTATCATCG
TCATCTTGATACTCTACCATGCTAACGACGTCGGCGTCCTGCTGCAGCACCGCCATCGGAAAGCGCATCACGCCC
CGTGCAGAAACGAGACGGGAGCCGGGAAATCACCATTACTGCTTCGTCGACTTCAAGACGCGCACCGAAGCCGCC
TCGGCCATCAAAGCCCTGAACGGCAAGCCCGTCCCCGGAGGCTCTCTCACGGTGGCCCTCGCACGCGGCATCCCG
GAAAAGCTGCTGACGCGGCATTTCGACGCCGAGCCCGAGGCTGCTTTCCGTCGACCTCGACAGGCGACGCCTACG
ACGGGACCGAGCAAGGCCATGGCGTCTACCGACTGGCGCCGTGCTGCTGATGGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail