Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4772
Gene name
LocationContig_449:738..3703
Strand-
Gene length (bp)2965
Transcript length (bp)2787
Coding sequence length (bp)2787
Protein length (aa) 929

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05362 Lon_C Lon protease (S16) C-terminal proteolytic domain 5.2E-68 702 905
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 5.9E-25 8 257
PF00004 AAA ATPase family associated with various cellular activities (AAA) 7.3E-22 476 614
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.8E-07 476 611
PF13541 ChlI Subunit ChlI of Mg-chelatase 1.4E-06 751 877

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SA85|LONP2_NEUCR Lon protease homolog 2, peroxisomal OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08303 PE=3 SV=1 3 928 0.0E+00
sp|Q5BH58|LONP2_EMENI Lon protease homolog 2, peroxisomal OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0122 PE=3 SV=1 9 915 0.0E+00
sp|A2RAF6|LONP2_ASPNC Lon protease homolog 2, peroxisomal OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g02980 PE=3 SV=1 5 928 0.0E+00
sp|Q4WVD9|LONP2_ASPFU Lon protease homolog 2, peroxisomal OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_5G11750 PE=3 SV=1 9 915 0.0E+00
sp|Q6C0L7|LONP2_YARLI Lon protease homolog 2, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F23595g PE=3 SV=1 7 908 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SA85|LONP2_NEUCR Lon protease homolog 2, peroxisomal OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08303 PE=3 SV=1 3 928 0.0E+00
sp|Q5BH58|LONP2_EMENI Lon protease homolog 2, peroxisomal OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0122 PE=3 SV=1 9 915 0.0E+00
sp|A2RAF6|LONP2_ASPNC Lon protease homolog 2, peroxisomal OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An18g02980 PE=3 SV=1 5 928 0.0E+00
sp|Q4WVD9|LONP2_ASPFU Lon protease homolog 2, peroxisomal OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_5G11750 PE=3 SV=1 9 915 0.0E+00
sp|Q6C0L7|LONP2_YARLI Lon protease homolog 2, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F23595g PE=3 SV=1 7 908 0.0E+00
sp|Q2IIK1|LON_ANADE Lon protease OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lon PE=3 SV=1 7 905 0.0E+00
sp|A9GBF1|LON2_SORC5 Lon protease 2 OS=Sorangium cellulosum (strain So ce56) GN=lon2 PE=3 SV=1 8 907 0.0E+00
sp|P36774|LON2_MYXXA Lon protease 2 OS=Myxococcus xanthus GN=lon2 PE=1 SV=3 103 905 2.0E-178
sp|Q1IPZ8|LON_KORVE Lon protease OS=Koribacter versatilis (strain Ellin345) GN=lon PE=3 SV=1 42 911 1.0E-177
sp|B5YFG2|LON_DICT6 Lon protease OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=lon PE=3 SV=1 82 918 2.0E-177
sp|A8ZX50|LON_DESOH Lon protease OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lon PE=3 SV=1 103 906 6.0E-177
sp|B0TFI9|LON_HELMI Lon protease OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lon PE=3 SV=1 101 905 8.0E-175
sp|Q2LVS9|LON_SYNAS Lon protease OS=Syntrophus aciditrophicus (strain SB) GN=lon PE=3 SV=1 102 906 1.0E-172
sp|B8EMF2|LON_METSB Lon protease OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lon PE=3 SV=1 103 904 3.0E-172
sp|B3E7K2|LON_GEOLS Lon protease OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=lon PE=3 SV=1 104 906 1.0E-171
sp|Q0AWF3|LON_SYNWW Lon protease OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lon PE=3 SV=1 95 904 7.0E-170
sp|A4J7L6|LON_DESRM Lon protease OS=Desulfotomaculum reducens (strain MI-1) GN=lon PE=3 SV=1 103 900 3.0E-169
sp|O04979|LONP2_SPIOL Lon protease homolog 2, peroxisomal OS=Spinacia oleracea PE=2 SV=2 16 900 1.0E-168
sp|B5EDX8|LON_GEOBB Lon protease OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lon PE=3 SV=1 316 904 2.0E-168
sp|Q5PQY6|LONP2_DANRE Lon protease homolog 2, peroxisomal OS=Danio rerio GN=lonp2 PE=2 SV=1 108 908 1.0E-167
sp|A9WGB5|LON_CHLAA Lon protease OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=lon PE=3 SV=1 104 906 2.0E-165
sp|Q3MIB4|LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus GN=Lonp2 PE=1 SV=2 98 908 3.0E-165
sp|Q39QP7|LON_GEOMG Lon protease OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lon PE=3 SV=1 102 895 3.0E-165
sp|Q3SX23|LONP2_BOVIN Lon protease homolog 2, peroxisomal OS=Bos taurus GN=LONP2 PE=2 SV=1 98 908 2.0E-164
sp|Q1MS21|LON_LAWIP Lon protease OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lon PE=3 SV=1 102 911 2.0E-164
sp|Q9DBN5|LONP2_MOUSE Lon protease homolog 2, peroxisomal OS=Mus musculus GN=Lonp2 PE=1 SV=1 98 928 7.0E-164
sp|A0RJ87|LON_BACAH Lon protease OS=Bacillus thuringiensis (strain Al Hakam) GN=lon PE=3 SV=1 103 904 9.0E-164
sp|P37945|LON1_BACSU Lon protease 1 OS=Bacillus subtilis (strain 168) GN=lon1 PE=1 SV=1 213 904 1.0E-163
sp|Q86WA8|LONP2_HUMAN Lon protease homolog 2, peroxisomal OS=Homo sapiens GN=LONP2 PE=1 SV=1 98 904 3.0E-163
sp|A4XJL4|LON_CALS8 Lon protease OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lon PE=3 SV=1 102 906 4.0E-163
sp|B2V6N0|LON_SULSY Lon protease OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=lon PE=3 SV=1 102 906 4.0E-163
sp|B8J198|LON_DESDA Lon protease OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=lon PE=3 SV=1 102 908 6.0E-163
sp|P36772|LON_BRECH Lon protease OS=Brevibacillus choshinensis GN=lon PE=3 SV=1 93 905 7.0E-163
sp|B8BDV1|LONP2_ORYSI Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. indica GN=LON1 PE=2 SV=1 9 904 2.0E-162
sp|P93647|LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays GN=LON1 PE=2 SV=1 4 904 5.0E-162
sp|Q0J032|LONP2_ORYSJ Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. japonica GN=Os09g0533400 PE=2 SV=1 9 904 1.0E-161
sp|Q2TAF8|LONP2_XENLA Lon protease homolog 2, peroxisomal OS=Xenopus laevis GN=lonp2 PE=2 SV=1 104 908 3.0E-161
sp|B4RI01|LON_PHEZH Lon protease OS=Phenylobacterium zucineum (strain HLK1) GN=lon PE=3 SV=1 92 904 7.0E-161
sp|Q5R6M5|LONP2_PONAB Lon protease homolog 2, peroxisomal OS=Pongo abelii GN=LONP2 PE=2 SV=1 98 904 2.0E-160
sp|A7NM80|LON_ROSCS Lon protease OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=lon PE=3 SV=1 98 912 4.0E-160
sp|B2TFQ5|LON_BURPP Lon protease OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lon PE=3 SV=1 218 910 5.0E-160
sp|B8F9K1|LON_DESAA Lon protease OS=Desulfatibacillum alkenivorans (strain AK-01) GN=lon PE=3 SV=1 85 904 5.0E-160
sp|A0LG61|LON2_SYNFM Lon protease 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lon2 PE=3 SV=1 95 917 1.0E-159
sp|Q3A334|LON2_PELCD Lon protease 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lon2 PE=3 SV=1 101 911 1.0E-159
sp|B3QSJ7|LON_CHLT3 Lon protease OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=lon PE=3 SV=1 128 883 1.0E-158
sp|A5FG89|LON_FLAJ1 Lon protease OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lon PE=3 SV=1 8 912 2.0E-158
sp|O64948|LONP2_ARATH Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana GN=LON2 PE=2 SV=1 4 900 3.0E-158
sp|A0LEE9|LON1_SYNFM Lon protease 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lon1 PE=3 SV=1 317 910 5.0E-158
sp|B8CY71|LON_HALOH Lon protease OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=lon PE=3 SV=1 100 907 1.0E-157
sp|O69177|LON_RHIME Lon protease OS=Rhizobium meliloti (strain 1021) GN=lon PE=3 SV=2 104 927 2.0E-157
sp|Q72JM6|LON2_THET2 Lon protease 2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lon2 PE=3 SV=1 8 906 2.0E-157
sp|Q11QT1|LON_CYTH3 Lon protease OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lon PE=3 SV=1 7 897 4.0E-157
sp|B1GZQ6|LON_UNCTG Lon protease OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=lon PE=3 SV=1 92 906 8.0E-157
sp|Q72CE6|LON_DESVH Lon protease OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lon PE=3 SV=1 316 904 1.0E-156
sp|B8G736|LON_CHLAD Lon protease OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=lon PE=3 SV=1 102 906 2.0E-156
sp|P43864|LON_HAEIN Lon protease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lon PE=3 SV=1 102 904 2.0E-155
sp|A6LD45|LON_PARD8 Lon protease OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lon PE=3 SV=1 8 906 3.0E-155
sp|A9F8L0|LON4_SORC5 Lon protease 4 OS=Sorangium cellulosum (strain So ce56) GN=lon4 PE=3 SV=1 102 904 3.0E-155
sp|Q3A701|LON1_PELCD Lon protease 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lon1 PE=3 SV=1 102 896 4.0E-155
sp|Q180E4|LON_PEPD6 Lon protease OS=Peptoclostridium difficile (strain 630) GN=lon PE=3 SV=2 321 904 1.0E-154
sp|O66605|LON_AQUAE Lon protease OS=Aquifex aeolicus (strain VF5) GN=lon PE=1 SV=1 207 906 1.0E-154
sp|P0CAW0|LON_CAUCR Lon protease OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lon PE=3 SV=1 103 905 1.0E-154
sp|B8GX12|LON_CAUCN Lon protease OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lon PE=3 SV=1 103 905 1.0E-154
sp|Q5H432|LON_XANOR Lon protease OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lon PE=3 SV=1 317 906 3.0E-154
sp|B2KCC0|LON_ELUMP Lon protease OS=Elusimicrobium minutum (strain Pei191) GN=lon PE=3 SV=1 95 908 3.0E-154
sp|Q72KS4|LON1_THET2 Lon protease 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lon1 PE=3 SV=1 215 905 6.0E-154
sp|P0A9M0|LON_ECOLI Lon protease OS=Escherichia coli (strain K12) GN=lon PE=1 SV=1 102 906 7.0E-154
sp|P0A9M1|LON_ECOL6 Lon protease OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lon PE=3 SV=1 102 906 7.0E-154
sp|Q6MGP8|LON2_BDEBA Lon protease 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lon2 PE=3 SV=1 103 911 2.0E-153
sp|A9B5N1|LON1_HERA2 Lon protease 1 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=lon1 PE=3 SV=1 102 906 2.0E-153
sp|P46067|LON_ERWAM Lon protease OS=Erwinia amylovora GN=lon PE=2 SV=1 102 913 3.0E-153
sp|A9B3R2|LON2_HERA2 Lon protease 2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=lon2 PE=3 SV=1 94 908 3.0E-153
sp|P74956|LON_VIBPA Lon protease OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lon PE=3 SV=2 103 906 2.0E-152
sp|Q32JJ5|LON_SHIDS Lon protease OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lon PE=3 SV=1 102 889 3.0E-152
sp|Q89A99|LON_BUCBP Lon protease OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lon PE=3 SV=1 102 913 3.0E-152
sp|A8HYF7|LON_AZOC5 Lon protease OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lon PE=3 SV=1 104 904 5.0E-152
sp|A6LSV5|LON_CLOB8 Lon protease OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=lon PE=3 SV=1 102 905 8.0E-152
sp|B5Y8Q8|LON_COPPD Lon protease OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=lon PE=3 SV=1 9 908 2.0E-151
sp|Q600B5|LON_MYCH2 Lon protease OS=Mycoplasma hyopneumoniae (strain 232) GN=lon PE=3 SV=1 311 908 6.0E-151
sp|A5EWF3|LON_DICNV Lon protease OS=Dichelobacter nodosus (strain VCS1703A) GN=lon PE=3 SV=1 103 912 7.0E-151
sp|A8Z5Z0|LON_SULMW Lon protease OS=Sulcia muelleri (strain GWSS) GN=lon PE=3 SV=1 313 906 4.0E-150
sp|Q6ML73|LON1_BDEBA Lon protease 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lon1 PE=3 SV=1 102 907 7.0E-150
sp|A9ETZ9|LON1_SORC5 Lon protease 1 OS=Sorangium cellulosum (strain So ce56) GN=lon1 PE=3 SV=1 220 904 7.0E-150
sp|Q026Q2|LON_SOLUE Lon protease OS=Solibacter usitatus (strain Ellin6076) GN=lon PE=3 SV=1 102 906 9.0E-150
sp|Q3JBB6|LON_NITOC Lon protease OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lon PE=3 SV=1 319 910 1.0E-149
sp|Q97FT9|LON_CLOAB Lon protease OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lon PE=3 SV=1 9 900 5.0E-149
sp|P77810|LON_AZOBR Lon protease OS=Azospirillum brasilense GN=lon PE=2 SV=1 103 905 8.0E-149
sp|Q8RHK0|LON_FUSNN Lon protease OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lon PE=3 SV=1 95 908 2.0E-148
sp|A0L516|LON_MAGMM Lon protease OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lon PE=3 SV=1 100 908 2.0E-148
sp|B3ERM8|LON_AMOA5 Lon protease OS=Amoebophilus asiaticus (strain 5a2) GN=lon PE=3 SV=1 101 906 2.0E-148
sp|B3CLB3|LON_WOLPP Lon protease OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lon PE=3 SV=1 213 906 3.0E-147
sp|Q1RID6|LON_RICBR Lon protease OS=Rickettsia bellii (strain RML369-C) GN=lon PE=3 SV=1 317 900 6.0E-147
sp|A9KH99|LON_CLOPH Lon protease OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lon PE=3 SV=1 95 905 1.0E-146
sp|P0C113|LON_BRUAB Lon protease OS=Brucella abortus biovar 1 (strain 9-941) GN=lon PE=3 SV=1 104 905 1.0E-146
sp|Q2YPX3|LON_BRUA2 Lon protease OS=Brucella abortus (strain 2308) GN=lon PE=2 SV=1 104 905 1.0E-146
sp|Q8G0I7|LON_BRUSU Lon protease OS=Brucella suis biovar 1 (strain 1330) GN=lon PE=3 SV=1 104 905 1.0E-146
sp|Q8YHC6|LON_BRUME Lon protease OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lon PE=3 SV=2 104 905 1.0E-146
sp|B2RII6|LON_PORG3 Lon protease OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lon PE=3 SV=1 100 905 2.0E-146
sp|Q6MTF4|LON_MYCMS Lon protease OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lon PE=3 SV=1 316 912 2.0E-146
sp|P36773|LON1_MYXXA Lon protease 1 OS=Myxococcus xanthus GN=lon1 PE=2 SV=1 103 905 3.0E-146
sp|A8F811|LON_PSELT Lon protease OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=lon PE=3 SV=1 104 904 7.0E-145
sp|Q2NEP8|LON_METST Lon protease OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=lon PE=3 SV=1 123 911 7.0E-145
sp|A8M1E8|LON_SALAI Lon protease OS=Salinispora arenicola (strain CNS-205) GN=lon PE=3 SV=1 316 906 2.0E-144
sp|B0TZA7|LON_FRAP2 Lon protease OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=lon PE=3 SV=1 319 908 2.0E-144
sp|Q6AK61|LON2_DESPS Lon protease 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lon2 PE=3 SV=1 310 900 9.0E-144
sp|B7GXS7|LON_ACIB3 Lon protease OS=Acinetobacter baumannii (strain AB307-0294) GN=lon PE=3 SV=1 325 906 9.0E-144
sp|A7HK39|LON_FERNB Lon protease OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=lon PE=3 SV=1 102 906 2.0E-143
sp|B3PN08|LON_MYCA5 Lon protease OS=Mycoplasma arthritidis (strain 158L3-1) GN=lon PE=3 SV=1 331 908 2.0E-143
sp|Q6KI22|LON_MYCMO Lon protease OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lon PE=3 SV=1 325 898 2.0E-143
sp|Q6BJJ8|LONP2_DEBHA Lon protease homolog 2, peroxisomal OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G01892g PE=3 SV=2 326 911 1.0E-142
sp|Q8K988|LON_BUCAP Lon protease OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lon PE=3 SV=1 102 914 3.0E-142
sp|A9GIS9|LON3_SORC5 Lon protease 3 OS=Sorangium cellulosum (strain So ce56) GN=lon3 PE=3 SV=1 80 912 2.0E-141
sp|Q31GE9|LON1_THICR Lon protease 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=lon1 PE=3 SV=1 103 906 2.0E-141
sp|O83536|LON_TREPA Lon protease OS=Treponema pallidum (strain Nichols) GN=lon PE=3 SV=1 56 909 7.0E-141
sp|P57549|LON_BUCAI Lon protease OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lon PE=3 SV=1 102 906 4.0E-140
sp|Q4ULN0|LON_RICFE Lon protease OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lon PE=3 SV=1 317 905 4.0E-140
sp|Q6ME13|LON_PARUW Lon protease OS=Protochlamydia amoebophila (strain UWE25) GN=lon PE=3 SV=1 67 912 4.0E-140
sp|Q68WS8|LON_RICTY Lon protease OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lon PE=3 SV=1 317 905 9.0E-140
sp|Q9PK50|LON_CHLMU Lon protease OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lon PE=3 SV=1 108 909 1.0E-139
sp|Q00WL5|LONM_OSTTA Lon protease homolog, mitochondrial OS=Ostreococcus tauri GN=Ot13g03040 PE=3 SV=2 317 908 1.0E-139
sp|Q59185|LON1_BORBU Lon protease 1 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lon1 PE=3 SV=1 102 908 1.0E-139
sp|Q9ZD92|LON_RICPR Lon protease OS=Rickettsia prowazekii (strain Madrid E) GN=lon PE=3 SV=1 317 905 2.0E-139
sp|Q2GE60|LON_NEOSM Lon protease OS=Neorickettsia sennetsu (strain Miyayama) GN=lon PE=3 SV=1 220 910 5.0E-139
sp|Q0RPW3|LON_FRAAA Lon protease OS=Frankia alni (strain ACN14a) GN=lon PE=3 SV=1 325 906 5.0E-139
sp|Q31FD3|LON2_THICR Lon protease 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=lon2 PE=3 SV=2 126 908 1.0E-138
sp|O84348|LON_CHLTR Lon protease OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lon PE=3 SV=1 108 909 1.0E-138
sp|Q92HZ1|LON_RICCN Lon protease OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lon PE=3 SV=2 317 905 2.0E-138
sp|Q9RXG4|LON_DEIRA Lon protease OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lon PE=3 SV=1 8 892 2.0E-138
sp|B5RL78|LON_BORDL Lon protease OS=Borrelia duttonii (strain Ly) GN=lon PE=3 SV=1 102 908 2.0E-137
sp|B0S2N4|LON_FINM2 Lon protease OS=Finegoldia magna (strain ATCC 29328) GN=lon PE=3 SV=1 102 904 4.0E-137
sp|Q6AS16|LON1_DESPS Lon protease 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lon1 PE=3 SV=1 97 908 7.0E-137
sp|Q2V573|LONP2_PICAN Lon protease homolog 2, peroxisomal OS=Pichia angusta GN=PLN PE=3 SV=1 314 881 1.0E-135
sp|B1AIY7|LON_UREP2 Lon protease OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=lon PE=3 SV=1 103 908 2.0E-135
sp|Q924S5|LONM_RAT Lon protease homolog, mitochondrial OS=Rattus norvegicus GN=Lonp1 PE=2 SV=1 316 909 2.0E-135
sp|Q8CGK3|LONM_MOUSE Lon protease homolog, mitochondrial OS=Mus musculus GN=Lonp1 PE=1 SV=2 316 909 6.0E-135
sp|P36776|LONM_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens GN=LONP1 PE=1 SV=2 316 912 2.0E-134
sp|Q72UP9|LON_LEPIC Lon protease OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lon PE=3 SV=1 60 908 5.0E-134
sp|Q9Z9F4|LON_CHLPN Lon protease OS=Chlamydia pneumoniae GN=lon PE=3 SV=1 108 909 1.0E-133
sp|Q2NJE3|LON_AYWBP Lon protease OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lon PE=3 SV=1 313 908 3.0E-133
sp|A4S6Y4|LONM_OSTLU Lon protease homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_41620 PE=3 SV=1 317 911 3.0E-133
sp|Q7KUT2|LONM_DROME Lon protease homolog, mitochondrial OS=Drosophila melanogaster GN=Lon PE=1 SV=1 316 910 5.0E-133
sp|O31147|LON_MYCSM Lon protease OS=Mycobacterium smegmatis GN=lon PE=1 SV=1 327 894 8.0E-133
sp|Q469F5|LON_METBF Lon protease OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lon PE=3 SV=1 317 905 3.0E-132
sp|A8Y3E2|LONP2_CAEBR Lon protease homolog 2, peroxisomal OS=Caenorhabditis briggsae GN=CBG23035 PE=3 SV=2 321 904 7.0E-132
sp|Q6CWS4|LONP2_KLULA Lon protease homolog 2, peroxisomal OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0B01892g PE=3 SV=1 317 910 1.0E-131
sp|A3LUF7|LONP2_PICST Lon protease homolog 2, peroxisomal OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_45980 PE=3 SV=2 357 895 2.0E-131
sp|P47481|LON_MYCGE Lon protease OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=lon PE=3 SV=1 318 899 2.0E-131
sp|A5IYF2|LON_MYCAP Lon protease OS=Mycoplasma agalactiae (strain PG2) GN=lon PE=3 SV=1 336 904 1.0E-130
sp|Q755E4|LONP2_ASHGO Lon protease homolog 2, peroxisomal OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFL121W PE=3 SV=2 220 913 3.0E-130
sp|Q59HJ6|LONM_BOVIN Lon protease homolog, mitochondrial OS=Bos taurus GN=LONP1 PE=1 SV=1 316 910 2.0E-129
sp|Q4A696|LON_MYCS5 Lon protease OS=Mycoplasma synoviae (strain 53) GN=lon PE=3 SV=1 336 910 1.0E-128
sp|A8XFM8|LONM_CAEBR Lon protease homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG12802 PE=3 SV=3 317 902 4.0E-128
sp|Q9XW87|LONP2_CAEEL Lon protease homolog 2, peroxisomal OS=Caenorhabditis elegans GN=Y75B8A.4 PE=3 SV=1 321 904 1.0E-127
sp|O44952|LONM_CAEEL Lon protease homolog, mitochondrial OS=Caenorhabditis elegans GN=C34B2.6 PE=3 SV=1 317 902 1.0E-127
sp|P36775|LONM_YEAST Lon protease homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIM1 PE=1 SV=2 214 893 3.0E-126
sp|O69300|LON_CAMJE Lon protease OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lon PE=2 SV=2 98 897 4.0E-126
sp|A7ZEJ3|LON_CAMC1 Lon protease OS=Campylobacter concisus (strain 13826) GN=lon PE=3 SV=1 315 905 2.0E-125
sp|B7FSL4|LONM_PHATC Lon protease homolog, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_18202 PE=3 SV=1 317 896 1.0E-124
sp|O51558|LON2_BORBU Lon protease 2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lon2 PE=3 SV=2 102 904 6.0E-124
sp|Q9M9L7|LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=LON4 PE=3 SV=1 334 912 1.0E-123
sp|B3CUN9|LON_ORITI Lon protease OS=Orientia tsutsugamushi (strain Ikeda) GN=lon PE=3 SV=1 432 898 1.0E-122
sp|Q59YV0|LONP2_CANAL Lon protease homolog 2, peroxisomal OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.6973 PE=3 SV=1 333 895 5.0E-122
sp|Q5AZT7|LONM_EMENI Lon protease homolog, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pim1 PE=3 SV=1 323 910 8.0E-122
sp|Q8EV77|LON_MYCPE Lon protease OS=Mycoplasma penetrans (strain HF-2) GN=lon PE=3 SV=1 364 897 1.0E-121
sp|P78025|LON_MYCPN Lon protease OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lon PE=3 SV=1 318 897 1.0E-121
sp|B9WEC4|LONP2_CANDC Lon protease homolog 2, peroxisomal OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_85340 PE=3 SV=1 253 895 3.0E-121
sp|A2QCJ2|LONM_ASPNC Lon protease homolog, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pim1 PE=3 SV=1 323 910 9.0E-121
sp|Q754Q9|LONM_ASHGO Lon protease homolog, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PIM1 PE=3 SV=2 173 910 2.0E-120
sp|P93655|LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana GN=LON1 PE=1 SV=2 130 908 3.0E-120
sp|Q54YV4|LONM1_DICDI Lon protease homolog, mitochondrial 1 OS=Dictyostelium discoideum GN=DDB_G0278063 PE=3 SV=3 317 913 7.0E-119
sp|Q4X0Z7|LONM_ASPFU Lon protease homolog, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pim1 PE=3 SV=1 323 908 1.0E-118
sp|Q550C8|LONM2_DICDI Lon protease homolog, mitochondrial 2 OS=Dictyostelium discoideum GN=DDB_0217928 PE=3 SV=1 322 910 1.0E-117
sp|Q9M9L8|LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana GN=LON3 PE=3 SV=1 334 912 2.0E-117
sp|Q09769|LONM_SCHPO Lon protease homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=3 SV=1 317 910 4.0E-117
sp|Q6CNR9|LONM_KLULA Lon protease homolog, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PIM1 PE=3 SV=1 316 893 4.0E-116
sp|P55995|LON_HELPY Lon protease OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lon PE=3 SV=1 105 904 9.0E-116
sp|Q9ZJL3|LON_HELPJ Lon protease OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lon PE=3 SV=1 105 904 6.0E-114
sp|Q6C0B5|LONM_YARLI Lon protease homolog, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PIM1 PE=3 SV=1 214 908 3.0E-112
sp|Q7S8C4|LONM_NEUCR Lon protease homolog, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pim1 PE=3 SV=1 317 918 2.0E-104
sp|Q6FPE6|LONM_CANGA Lon protease homolog, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PIM1 PE=3 SV=1 316 684 2.0E-85
sp|P0CQ17|LONM_CRYNB Lon protease homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PIM1 PE=3 SV=1 326 685 3.0E-79
sp|P0CQ16|LONM_CRYNJ Lon protease homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PIM1 PE=3 SV=1 326 685 3.0E-79
sp|A2YQ56|LONM_ORYSI Lon protease homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_27415 PE=2 SV=1 334 685 6.0E-77
sp|Q69UZ3|LONM_ORYSJ Lon protease homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0689300 PE=2 SV=1 334 685 6.0E-77
sp|P93648|LONM_MAIZE Lon protease homolog, mitochondrial OS=Zea mays GN=LON2 PE=1 SV=1 334 685 7.0E-77
sp|A3M072|LONM_PICST Lon protease homolog, mitochondrial (Fragment) OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PIM1 PE=3 SV=3 220 691 5.0E-71
sp|Q6BKJ4|LONM_DEBHA Lon protease homolog, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PIM1 PE=3 SV=2 220 707 4.0E-70
sp|B9WLN5|LONM_CANDC Lon protease homolog, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PIM1 PE=3 SV=1 214 725 9.0E-67
sp|Q5A6N1|LONM_CANAL Lon protease homolog, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIM1 PE=3 SV=1 214 698 1.0E-66
sp|Q5UPT0|LONH_MIMIV Lon protease homolog OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L251 PE=3 SV=1 478 904 5.0E-51
sp|P0CQ17|LONM_CRYNB Lon protease homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PIM1 PE=3 SV=1 700 913 1.0E-42
sp|P0CQ16|LONM_CRYNJ Lon protease homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PIM1 PE=3 SV=1 700 913 1.0E-42
sp|Q6BKJ4|LONM_DEBHA Lon protease homolog, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PIM1 PE=3 SV=2 700 911 2.0E-38
sp|A3M072|LONM_PICST Lon protease homolog, mitochondrial (Fragment) OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PIM1 PE=3 SV=3 695 910 2.0E-37
sp|P93648|LONM_MAIZE Lon protease homolog, mitochondrial OS=Zea mays GN=LON2 PE=1 SV=1 704 908 9.0E-35
sp|Q6FPE6|LONM_CANGA Lon protease homolog, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PIM1 PE=3 SV=1 663 893 1.0E-34
sp|A2YQ56|LONM_ORYSI Lon protease homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_27415 PE=2 SV=1 704 908 5.0E-34
sp|Q69UZ3|LONM_ORYSJ Lon protease homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0689300 PE=2 SV=1 704 908 7.0E-34
sp|Q5A6N1|LONM_CANAL Lon protease homolog, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIM1 PE=3 SV=1 706 913 8.0E-34
sp|B9WLN5|LONM_CANDC Lon protease homolog, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PIM1 PE=3 SV=1 706 913 3.0E-33
sp|P42425|LON2_BACSU Lon protease 2 OS=Bacillus subtilis (strain 168) GN=lon2 PE=2 SV=2 476 904 4.0E-17
sp|Q9HSC3|LONB_HALSA Archaeal Lon protease OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_0303G PE=3 SV=1 727 904 1.0E-13
sp|O58221|LONB_PYRHO Archaeal Lon protease OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0452 PE=3 SV=2 727 912 9.0E-13
sp|O29883|LONB_ARCFU Archaeal Lon protease OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0364 PE=1 SV=1 649 910 1.0E-12
sp|O26878|LONB_METTH Archaeal Lon protease OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_785 PE=3 SV=1 649 904 2.0E-12
sp|Q9UYC6|LONB_PYRAB Archaeal Lon protease OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=lon PE=3 SV=1 649 912 3.0E-12
sp|Q8NKS6|LONB_THEKO Archaeal Lon protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=lon PE=1 SV=1 727 910 4.0E-12
sp|Q58812|LONB_METJA Archaeal Lon protease OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1417 PE=1 SV=1 709 918 9.0E-12
sp|Q9HJ89|LONB_THEAC Archaeal Lon protease OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1081 PE=1 SV=1 649 911 2.0E-11
sp|P58274|LONB_THEVO Archaeal Lon protease OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV0493 PE=3 SV=1 649 881 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0004176 ATP-dependent peptidase activity Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0005524 ATP binding Yes
GO:0006508 proteolysis Yes
GO:0097159 organic cyclic compound binding No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0008236 serine-type peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0008152 metabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0005488 binding No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0016462 pyrophosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0140657 ATP-dependent activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4708
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2391
Ophiocordyceps australis map64 (Brazil) OphauB2|2701
Ophiocordyceps camponoti-floridani Ophcf2|04080
Ophiocordyceps camponoti-rufipedis Ophun1|4772 (this protein)
Ophiocordyceps kimflemingae Ophio5|3379
Ophiocordyceps subramaniannii Hirsu2|9906

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4772
MGRSQVATLPVIPLARGAVLLPGLVQRITVSSGRPDIAALVAHVYERAAAKGRDGRIDGIPIACVPVSSPLVGPT
GQLLISNGDELDGARFQHIETAGADGQDLFGFGVAARIVGIDGRGSGEFALRVEGKSRIRVDSITSEKPFFEAKV
TYFPDAIDVTDKQLQDLFALLKLRSRELVTILRISSLLPRSRDGPVLSPSVTKRLGMLIMKRELKEAGLLADFIT
NLVETSHEEKLSVLAALDVKVRMTKVIELLERQLGGIKNVLRITTLTSVPVQILDRLGENPANKSNPSTPTPGMS
FVPPSGQTPSGHDAADDQEASELDELKKKLHAARLPADVAKAVDRELRRLQRMMPMNQEYQVTRNWLETLSEIPW
TATTDDRLGPETLVRARKQLDDDHYGLDKVKRRLIEYLAVLRLKQSINDEVDEKIRRAEAESRDIDADEALQTTA
NGDGLAYGAKLQMLRSQRLVDKSPIMLLVGPPGVGKTSLAKSVATALGRKFHRISLGGVRDEAEIRGHRRTYVAA
MPGLIVQGLRKVGVANPVFLLDEIDKVGLASVHGDPSAAMLEVLDPEQNHSFQDHYVGMPIDLSRILFIATANTL
DTIPAPLLDRMEMIYLPGYTTLEKRHIAMQHLIPKQMRVNGLAEGLVDFKQDVVSKIIESYTRESGVRNLEREIG
SVCRAKAVEFAEARDGGDLDRYRSQLTVADVEDILGIEKFEDEIAEKTSRPGIVTGLVAYSSGGNGSILFIEVAD
MPGSGRVQLTGKLGDVLKESVEVALSWVKAHAFELGLTSEPAADIMKQRSIHVHCPSGAIPKDGPSSGIGQAVAL
ISLFSGKPVPPTMAMTGEISLRGRVTAVGGIKEKLIGALRAGVKTVLLPAQNRKDIKDLPQEVKDGLEIVFVSHI
WEAIRLVWPDSHWAGDSRAAAAGIDSRL*
Coding >Ophun1|4772
ATGGGCAGGTCACAGGTTGCCACGCTGCCGGTGATACCGCTCGCCAGGGGTGCTGTTCTCTTGCCCGGGCTCGTC
CAGCGCATCACCGTCAGCTCCGGACGTCCCGATATCGCGGCTCTTGTTGCCCACGTCTATGAGAGGGCGGCTGCC
AAGGGCCGAGACGGCCGTATCGACGGCATCCCCATCGCTTGTGTCCCTGTGTCCTCGCCTCTCGTCGGTCCTACG
GGACAGCTCCTCATCAGCAACGGCGACGAGCTTGACGGGGCTCGATTTCAGCATATTGAGACTGCTGGGGCTGAT
GGTCAGGATCTTTTCGGCTTCGGCGTCGCTGCCAGGATTGTCGGCATCGACGGCCGCGGCTCGGGCGAGTTTGCC
CTCCGGGTCGAGGGCAAATCTCGCATCAGGGTAGACAGCATCACGAGCGAGAAGCCTTTCTTTGAGGCCAAGGTC
ACCTACTTTCCCGACGCAATCGACGTCACCGACAAGCAACTGCAGGATCTGTTTGCGCTGCTCAAGCTGCGCTCA
AGGGAACTCGTCACTATCCTGCGCATCTCTTCGCTGCTGCCGCGGTCTAGAGATGGACCTGTTCTGTCGCCTTCA
GTGACGAAGCGTCTCGGAATGCTCATCATGAAGAGGGAGCTCAAGGAGGCTGGCTTACTCGCCGACTTCATCACC
AATTTGGTAGAAACTTCTCACGAGGAGAAGCTCAGCGTTCTGGCCGCCTTGGACGTCAAGGTTCGGATGACAAAG
GTCATTGAGCTGCTCGAGCGCCAGTTGGGGGGCATCAAGAACGTATTGAGAATCACCACTTTGACTTCGGTGCCT
GTTCAGATACTCGATCGTCTCGGCGAGAACCCGGCCAACAAGTCGAATCCCTCTACCCCAACACCCGGCATGAGC
TTCGTCCCCCCTTCCGGCCAGACGCCTTCCGGCCACGATGCCGCCGACGATCAGGAGGCCAGCGAGCTGGACGAG
CTCAAGAAGAAGCTTCATGCGGCGAGGTTGCCGGCAGACGTGGCCAAGGCCGTCGATCGCGAGCTGAGACGGCTG
CAGAGGATGATGCCCATGAACCAGGAGTATCAGGTCACGCGCAACTGGCTTGAGACGTTGTCGGAGATACCCTGG
ACTGCGACTACGGACGATCGACTCGGCCCCGAGACGCTGGTCAGGGCGCGTAAACAGCTGGACGACGACCACTAC
GGCCTGGACAAGGTCAAGCGGAGACTGATCGAGTACCTGGCCGTGCTGAGGCTTAAGCAGTCCATCAACGACGAG
GTCGACGAAAAGATCCGCAGGGCAGAGGCGGAATCCCGCGACATCGATGCCGACGAGGCGCTCCAGACGACGGCC
AATGGTGACGGACTCGCTTACGGCGCCAAGTTGCAGATGCTCCGATCGCAGCGGCTGGTGGACAAGTCGCCCATC
ATGCTGCTGGTCGGCCCCCCGGGCGTGGGCAAGACCAGCCTGGCCAAGTCGGTGGCCACTGCGCTGGGCCGCAAG
TTCCATCGCATCTCGCTCGGCGGCGTCAGGGACGAGGCCGAGATCCGCGGCCACCGGAGGACGTACGTGGCTGCG
ATGCCGGGTCTCATCGTCCAGGGCCTTCGCAAGGTGGGCGTGGCCAACCCCGTCTTCCTCCTGGACGAGATCGAC
AAGGTGGGCCTGGCCAGCGTTCACGGCGATCCTTCGGCGGCCATGCTCGAGGTGCTGGATCCGGAGCAGAACCAC
TCGTTCCAGGATCATTACGTCGGGATGCCCATCGACCTCTCGAGGATCTTGTTCATCGCGACGGCCAACACGCTC
GACACGATCCCGGCGCCGCTACTAGACCGGATGGAGATGATCTACCTGCCGGGCTATACGACGCTGGAGAAGCGG
CATATTGCCATGCAGCACTTGATACCCAAGCAGATGCGCGTCAACGGTCTAGCCGAGGGCCTGGTCGACTTCAAG
CAGGACGTCGTGTCCAAGATTATCGAGTCGTACACTCGTGAATCAGGGGTTCGCAACCTGGAACGCGAGATCGGC
TCCGTGTGTCGTGCCAAGGCGGTCGAATTCGCCGAGGCCCGGGATGGTGGTGACCTGGATCGATACCGGTCGCAG
TTGACGGTGGCCGACGTCGAGGACATCTTGGGCATCGAGAAGTTTGAGGACGAGATTGCGGAGAAGACGAGCCGG
CCGGGCATCGTGACGGGTCTGGTGGCCTACAGCTCGGGCGGCAACGGGAGCATCCTCTTCATCGAGGTGGCCGAC
ATGCCGGGCAGCGGCAGGGTGCAGCTGACGGGCAAGCTGGGTGACGTGCTGAAGGAGAGCGTCGAGGTGGCCCTG
TCGTGGGTCAAGGCTCACGCCTTTGAGCTGGGGCTGACGTCGGAGCCGGCGGCCGACATCATGAAGCAGCGGAGC
ATCCACGTCCACTGTCCGTCGGGGGCCATCCCCAAGGACGGTCCGAGCAGCGGCATCGGTCAGGCCGTCGCCCTG
ATTTCTCTGTTTTCCGGCAAGCCGGTGCCGCCTACCATGGCCATGACGGGCGAGATATCACTCCGCGGCCGGGTC
ACGGCGGTCGGAGGCATCAAGGAGAAGTTGATCGGGGCGCTTCGGGCCGGTGTCAAGACGGTGCTGCTACCGGCG
CAGAACCGAAAGGACATCAAGGACCTGCCACAAGAAGTCAAGGACGGGCTCGAGATAGTCTTTGTCAGCCACATA
TGGGAAGCGATCCGGTTGGTATGGCCGGACTCGCACTGGGCCGGTGACAGCAGGGCAGCGGCAGCGGGCATCGAC
AGCCGACTGTGA
Transcript >Ophun1|4772
ATGGGCAGGTCACAGGTTGCCACGCTGCCGGTGATACCGCTCGCCAGGGGTGCTGTTCTCTTGCCCGGGCTCGTC
CAGCGCATCACCGTCAGCTCCGGACGTCCCGATATCGCGGCTCTTGTTGCCCACGTCTATGAGAGGGCGGCTGCC
AAGGGCCGAGACGGCCGTATCGACGGCATCCCCATCGCTTGTGTCCCTGTGTCCTCGCCTCTCGTCGGTCCTACG
GGACAGCTCCTCATCAGCAACGGCGACGAGCTTGACGGGGCTCGATTTCAGCATATTGAGACTGCTGGGGCTGAT
GGTCAGGATCTTTTCGGCTTCGGCGTCGCTGCCAGGATTGTCGGCATCGACGGCCGCGGCTCGGGCGAGTTTGCC
CTCCGGGTCGAGGGCAAATCTCGCATCAGGGTAGACAGCATCACGAGCGAGAAGCCTTTCTTTGAGGCCAAGGTC
ACCTACTTTCCCGACGCAATCGACGTCACCGACAAGCAACTGCAGGATCTGTTTGCGCTGCTCAAGCTGCGCTCA
AGGGAACTCGTCACTATCCTGCGCATCTCTTCGCTGCTGCCGCGGTCTAGAGATGGACCTGTTCTGTCGCCTTCA
GTGACGAAGCGTCTCGGAATGCTCATCATGAAGAGGGAGCTCAAGGAGGCTGGCTTACTCGCCGACTTCATCACC
AATTTGGTAGAAACTTCTCACGAGGAGAAGCTCAGCGTTCTGGCCGCCTTGGACGTCAAGGTTCGGATGACAAAG
GTCATTGAGCTGCTCGAGCGCCAGTTGGGGGGCATCAAGAACGTATTGAGAATCACCACTTTGACTTCGGTGCCT
GTTCAGATACTCGATCGTCTCGGCGAGAACCCGGCCAACAAGTCGAATCCCTCTACCCCAACACCCGGCATGAGC
TTCGTCCCCCCTTCCGGCCAGACGCCTTCCGGCCACGATGCCGCCGACGATCAGGAGGCCAGCGAGCTGGACGAG
CTCAAGAAGAAGCTTCATGCGGCGAGGTTGCCGGCAGACGTGGCCAAGGCCGTCGATCGCGAGCTGAGACGGCTG
CAGAGGATGATGCCCATGAACCAGGAGTATCAGGTCACGCGCAACTGGCTTGAGACGTTGTCGGAGATACCCTGG
ACTGCGACTACGGACGATCGACTCGGCCCCGAGACGCTGGTCAGGGCGCGTAAACAGCTGGACGACGACCACTAC
GGCCTGGACAAGGTCAAGCGGAGACTGATCGAGTACCTGGCCGTGCTGAGGCTTAAGCAGTCCATCAACGACGAG
GTCGACGAAAAGATCCGCAGGGCAGAGGCGGAATCCCGCGACATCGATGCCGACGAGGCGCTCCAGACGACGGCC
AATGGTGACGGACTCGCTTACGGCGCCAAGTTGCAGATGCTCCGATCGCAGCGGCTGGTGGACAAGTCGCCCATC
ATGCTGCTGGTCGGCCCCCCGGGCGTGGGCAAGACCAGCCTGGCCAAGTCGGTGGCCACTGCGCTGGGCCGCAAG
TTCCATCGCATCTCGCTCGGCGGCGTCAGGGACGAGGCCGAGATCCGCGGCCACCGGAGGACGTACGTGGCTGCG
ATGCCGGGTCTCATCGTCCAGGGCCTTCGCAAGGTGGGCGTGGCCAACCCCGTCTTCCTCCTGGACGAGATCGAC
AAGGTGGGCCTGGCCAGCGTTCACGGCGATCCTTCGGCGGCCATGCTCGAGGTGCTGGATCCGGAGCAGAACCAC
TCGTTCCAGGATCATTACGTCGGGATGCCCATCGACCTCTCGAGGATCTTGTTCATCGCGACGGCCAACACGCTC
GACACGATCCCGGCGCCGCTACTAGACCGGATGGAGATGATCTACCTGCCGGGCTATACGACGCTGGAGAAGCGG
CATATTGCCATGCAGCACTTGATACCCAAGCAGATGCGCGTCAACGGTCTAGCCGAGGGCCTGGTCGACTTCAAG
CAGGACGTCGTGTCCAAGATTATCGAGTCGTACACTCGTGAATCAGGGGTTCGCAACCTGGAACGCGAGATCGGC
TCCGTGTGTCGTGCCAAGGCGGTCGAATTCGCCGAGGCCCGGGATGGTGGTGACCTGGATCGATACCGGTCGCAG
TTGACGGTGGCCGACGTCGAGGACATCTTGGGCATCGAGAAGTTTGAGGACGAGATTGCGGAGAAGACGAGCCGG
CCGGGCATCGTGACGGGTCTGGTGGCCTACAGCTCGGGCGGCAACGGGAGCATCCTCTTCATCGAGGTGGCCGAC
ATGCCGGGCAGCGGCAGGGTGCAGCTGACGGGCAAGCTGGGTGACGTGCTGAAGGAGAGCGTCGAGGTGGCCCTG
TCGTGGGTCAAGGCTCACGCCTTTGAGCTGGGGCTGACGTCGGAGCCGGCGGCCGACATCATGAAGCAGCGGAGC
ATCCACGTCCACTGTCCGTCGGGGGCCATCCCCAAGGACGGTCCGAGCAGCGGCATCGGTCAGGCCGTCGCCCTG
ATTTCTCTGTTTTCCGGCAAGCCGGTGCCGCCTACCATGGCCATGACGGGCGAGATATCACTCCGCGGCCGGGTC
ACGGCGGTCGGAGGCATCAAGGAGAAGTTGATCGGGGCGCTTCGGGCCGGTGTCAAGACGGTGCTGCTACCGGCG
CAGAACCGAAAGGACATCAAGGACCTGCCACAAGAAGTCAAGGACGGGCTCGAGATAGTCTTTGTCAGCCACATA
TGGGAAGCGATCCGGTTGGTATGGCCGGACTCGCACTGGGCCGGTGACAGCAGGGCAGCGGCAGCGGGCATCGAC
AGCCGACTGTGA
Gene >Ophun1|4772
ATGGGCAGGTCACAGGTTGCCACGCTGCCGGTGATACCGCTCGCCAGGGGTGCTGTTCTCTTGCCCGGGCTCGTC
CAGCGCATCACCGTCAGCTCCGGACGTCCCGATATCGCGGCTCTTGTTGCCCACGTCTATGAGAGGGCGGCTGCC
AAGGGCCGAGACGGCCGTATCGACGGCATCCCCATCGCTTGTGTCCCTGTGTCCTCGCCTCTCGTCGGTCCTACG
GGACAGCTCCTCATCAGCAACGGCGACGAGCTTGACGGGGCTCGATTTCAGCATATTGAGACTGCTGGGGCTGAT
GGTCAGGATCTTTTCGGCTTCGGCGTCGCTGCCAGGATTGTCGGCATCGACGGCCGCGGCTCGGGCGAGTTTGCC
CTCCGGGTCGAGGGCAAATCTCGCATCAGGGTAGACAGCATCACGAGCGAGAAGCCTTTCTTTGAGGCCAAGGTC
ACCTACTTTCCCGACGCAAGTCTGTCTCCCTCCGCGGCTCTCTATCGGCATACATAAGTGCTGACACACCGCAGT
CGACGTCACCGACAAGCAACTGCAGGATCTGTTTGCGCTGCTCAAGCTGCGCTCAAGGGAACTCGTCACTATCCT
GCGCATCTCTTCGCTGCTGCCGCGGTCTAGAGATGGACCTGTTCTGTCGCCTTCAGTGACGAAGCGTCTCGGAAT
GCTCATCATGAAGAGGGAGCTCAAGGAGGCTGGCTTACTCGCCGACTTCATCACCAATTTGGTAGAAACTTCTCA
CGAGGAGAAGCTCAGCGTTCTGGCCGCCTTGGACGTCAAGGTTCGGATGACAAAGGTCATTGAGCTGCTCGAGCG
CCAGTTGGGGGGCATCAAGAACGTATTGAGAATCACCACTTTGACTTCGGTGCCTGTTCAGATACTCGATCGTCT
CGGCGAGAACCCGGCCAACAAGTCGAATCCCTCTACCCCAACACCCGGCATGAGCTTCGTCCCCCCTTCCGGCCA
GACGCCTTCCGGCCACGATGCCGCCGACGATCAGGAGGCCAGCGAGCTGGACGAGCTCAAGAAGAAGCTTCATGC
GGCGAGGTTGCCGGCAGACGTGGCCAAGGCCGTCGATCGCGAGCTGAGACGGCTGCAGAGGATGATGCCCATGAA
CCAGGAGTATCAGGTCACGCGCAACTGGCTTGAGACGTTGTCGGAGATACCCTGGACTGCGACTACGGACGATCG
ACTCGGCCCCGAGACGCTGGTCAGGGCGCGTAAACAGCTGGACGACGACCACTACGGCCTGGACAAGGTCAAGCG
GAGACTGATCGAGTACCTGGCCGTGCTGAGGCTTAAGCAGTCCATCAACGACGAGGTCGACGAAAAGATCCGCAG
GGCAGAGGCGGAATCCCGCGACATCGATGCCGACGAGGCGCTCCAGACGACGGCCAATGGTGACGGACTCGCTTA
CGGCGCCAAGTTGCAGATGCTCCGATCGCAGCGGCTGGTGGACAAGTCGCCCATCATGCTGCTGGTCGGCCCCCC
GGGCGTGGGCAAGACCAGCCTGGCCAAGTCGGTGGCCACTGCGCTGGGCCGCAAGTTCCATCGCATCTCGCTCGG
CGGCGTCAGGGACGAGGCCGAGATCCGCGGCCACCGGAGGACGTACGTGGCTGCGATGCCGGGTCTCATCGTCCA
GGGCCTTCGCAAGGTGGGCGTGGCCAACCCCGTCTTCCTCCTGGACGAGATCGACAAGGTGGGCCTGGCCAGCGT
TCACGGCGATCCTTCGGCGGCCATGCTCGAGGTGCTGGATCCGGAGCAGAACCACTCGTTCCAGGATCATTACGT
CGGGATGCCCATCGACCTCTCGAGGATCTTGTTCATCGCGACGGCCAACACGCTCGACACGATCCCGGCGCCGCT
ACTAGACCGGATGGAGATGATCTACCTGCCGGGCTATACGACGCTGGAGAAGCGGCATATTGCCATGCAGCACTT
GATACCCAAGCAGATGCGCGTCAACGGTCTAGCCGAGGGCCTGGTCGACTTCAAGCAGGACGTCGTGTCCAAGAT
TATCGAGTCGTACACTCGTGAATCAGGGGTTCGCAACCTGGAACGCGAGATCGGCTCCGTGTGTCGTGCCAAGGC
GGTCGAATTCGCCGAGGCCCGGGATGGTGGTGACCTGGATCGATACCGGTCGCAGTTGACGGTGGCCGACGTCGA
GGACATCTTGGGCATCGAGAAGTTTGAGGACGAGATTGCGGAGAAGACGAGCCGGCCGGGCATCGTGACGGGTCT
GGTGGCCTACAGCTCGGGCGGCAACGGGAGCATCCTCTTCATCGAGGTGGCCGACATGCCGGGCAGCGGCAGGGT
GCAGCTGACGGGCAAGCTGGGTGACGTGCTGAAGGAGAGCGTCGAGGTGGCCCTGTCGTGGGTCAAGGCTCACGC
CTTTGAGCTGGGGCTGACGTCGGAGCCGGCGGCCGACATCATGAAGCAGCGGAGCATCCACGTCCACTGTCCGTC
GGGGGCCATCCCCAAGGACGGTCCGAGCAGCGGCATCGGTCAGGCCGTCGCCCTGATTTCTCTGTTTTCCGGCAA
GCCGGTGCCGCCTACCATGGCCATGACGGTACGCGTGCGGTGGTCCGAGAGACGGAATGGCGAAGGAAGAAGGAA
GGAGGCTGACGCGTGTGACAGGGCGAGATATCACTCCGCGGCCGGGTCACGGCGGTCGGAGGCATCAAGGAGAAG
TTGATCGGGGCGCTTCGGGCCGGTGTCAAGACGGTGCTGCTACCGGCGCAGAACCGAAAGGACATCAAGGACCTG
CCACAAGAAGTCAAGGACGGGCTCGAGATAGTCTTTGTCAGGTAAGGGGGCTCTCTCGGGGGACCATGGTATCGC
AAAACTGACGGTGGACAACAGCCACATATGGGAAGCGATCCGGTTGGTATGGCCGGACTCGCACTGGGCCGGTGA
CAGCAGGGCAGCGGCAGCGGGCATCGACAGCCGACTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail