Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4770
Gene name
LocationContig_448:11936..14087
Strand-
Gene length (bp)2151
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00733 Asn_synthase Asparagine synthase 3.9E-89 213 558
PF13537 GATase_7 Glutamine amidotransferase domain 2.9E-36 47 166
PF13522 GATase_6 Glutamine amidotransferase domain 9.8E-29 32 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31752|ASNS_ASPOF Asparagine synthetase [glutamine-hydrolyzing] OS=Asparagus officinalis PE=2 SV=2 1 576 0.0E+00
sp|P78753|ASNS_SCHPO Probable asparagine synthetase [glutamine-hydrolyzing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asn1 PE=1 SV=3 1 573 0.0E+00
sp|O24338|ASNS_SANAU Asparagine synthetase [glutamine-hydrolyzing] OS=Sandersonia aurantiaca GN=AND1 PE=2 SV=3 1 543 0.0E+00
sp|Q10MX3|ASNS1_ORYSJ Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Oryza sativa subsp. japonica GN=Os03g0291500 PE=2 SV=1 1 568 0.0E+00
sp|P49093|ASNS2_LOTJA Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Lotus japonicus GN=AS2 PE=2 SV=2 1 577 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31752|ASNS_ASPOF Asparagine synthetase [glutamine-hydrolyzing] OS=Asparagus officinalis PE=2 SV=2 1 576 0.0E+00
sp|P78753|ASNS_SCHPO Probable asparagine synthetase [glutamine-hydrolyzing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asn1 PE=1 SV=3 1 573 0.0E+00
sp|O24338|ASNS_SANAU Asparagine synthetase [glutamine-hydrolyzing] OS=Sandersonia aurantiaca GN=AND1 PE=2 SV=3 1 543 0.0E+00
sp|Q10MX3|ASNS1_ORYSJ Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Oryza sativa subsp. japonica GN=Os03g0291500 PE=2 SV=1 1 568 0.0E+00
sp|P49093|ASNS2_LOTJA Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Lotus japonicus GN=AS2 PE=2 SV=2 1 577 0.0E+00
sp|P49091|ASNS_BRAOL Asparagine synthetase [glutamine-hydrolyzing] OS=Brassica oleracea PE=2 SV=2 1 576 0.0E+00
sp|P22106|ASNB_ECOLI Asparagine synthetase B [glutamine-hydrolyzing] OS=Escherichia coli (strain K12) GN=asnB PE=1 SV=3 1 575 0.0E+00
sp|P19252|ASNS2_PEA Asparagine synthetase, root [glutamine-hydrolyzing] OS=Pisum sativum GN=AS2 PE=2 SV=3 1 576 0.0E+00
sp|P19251|ASNS1_PEA Asparagine synthetase, nodule [glutamine-hydrolyzing] OS=Pisum sativum GN=AS1 PE=2 SV=3 1 576 0.0E+00
sp|P49094|ASNS_MAIZE Asparagine synthetase [glutamine-hydrolyzing] OS=Zea mays GN=ASN1 PE=2 SV=2 1 571 0.0E+00
sp|O24661|ASNS_TRIVS Asparagine synthetase [glutamine-hydrolyzing] OS=Triphysaria versicolor GN=AS PE=2 SV=3 1 569 0.0E+00
sp|P49078|ASNS1_ARATH Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Arabidopsis thaliana GN=ASN1 PE=2 SV=2 1 576 0.0E+00
sp|P49092|ASNS1_LOTJA Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Lotus japonicus GN=AS1 PE=2 SV=2 1 577 0.0E+00
sp|Q9LFU1|ASNS3_ARATH Asparagine synthetase [glutamine-hydrolyzing] 3 OS=Arabidopsis thaliana GN=ASN3 PE=2 SV=1 1 577 0.0E+00
sp|Q9LV77|ASNS2_ARATH Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Arabidopsis thaliana GN=ASN2 PE=2 SV=1 1 572 0.0E+00
sp|Q43011|ASNS2_ORYSJ Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Oryza sativa subsp. japonica GN=Os06g0265000 PE=2 SV=3 1 577 0.0E+00
sp|Q54MB4|ASNS_DICDI Probable asparagine synthetase [glutamine-hydrolyzing] OS=Dictyostelium discoideum GN=asns PE=1 SV=1 1 573 0.0E+00
sp|P49089|ASNS1_YEAST Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASN1 PE=1 SV=2 1 571 0.0E+00
sp|P49090|ASNS2_YEAST Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASN2 PE=1 SV=2 1 571 0.0E+00
sp|P19891|ASNS_CRIGR Asparagine synthetase [glutamine-hydrolyzing] OS=Cricetulus griseus GN=ASNS PE=2 SV=2 1 569 1.0E-93
sp|P49088|ASNS_RAT Asparagine synthetase [glutamine-hydrolyzing] OS=Rattus norvegicus GN=Asns PE=2 SV=3 1 569 3.0E-93
sp|Q61024|ASNS_MOUSE Asparagine synthetase [glutamine-hydrolyzing] OS=Mus musculus GN=Asns PE=1 SV=3 1 569 3.0E-93
sp|Q5UQE1|ASNS_MIMIV Probable asparagine synthetase [glutamine-hydrolyzing] OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R475 PE=3 SV=3 1 565 2.0E-92
sp|P17714|ASNS_MESAU Asparagine synthetase [glutamine-hydrolyzing] OS=Mesocricetus auratus GN=ASNS PE=1 SV=3 1 569 2.0E-91
sp|Q5ZJU3|ASNS_CHICK Asparagine synthetase [glutamine-hydrolyzing] OS=Gallus gallus GN=ASNS PE=2 SV=3 1 577 1.0E-87
sp|P08243|ASNS_HUMAN Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens GN=ASNS PE=1 SV=4 1 569 4.0E-86
sp|Q5R6W9|ASNS_PONAB Asparagine synthetase [glutamine-hydrolyzing] OS=Pongo abelii GN=ASNS PE=2 SV=3 1 569 7.0E-86
sp|Q1LZA3|ASNS_BOVIN Asparagine synthetase [glutamine-hydrolyzing] OS=Bos taurus GN=ASNS PE=2 SV=3 1 573 2.0E-85
sp|P54420|ASNB_BACSU Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Bacillus subtilis (strain 168) GN=asnB PE=1 SV=2 1 386 3.0E-38
sp|Q58516|ASNH1_METJA Putative asparagine synthetase [glutamine-hydrolyzing] 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1116 PE=3 SV=1 20 450 1.0E-35
sp|O05272|ASNO_BACSU Asparagine synthetase [glutamine-hydrolyzing] 3 OS=Bacillus subtilis (strain 168) GN=asnO PE=1 SV=3 1 489 1.0E-33
sp|Q58456|ASNH2_METJA Putative asparagine synthetase [glutamine-hydrolyzing] 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1056 PE=3 SV=3 1 387 4.0E-28
sp|P9WN33|ASNH_MYCTU Putative asparagine synthetase [glutamine-hydrolyzing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=asnB PE=1 SV=1 27 389 5.0E-28
sp|P9WN32|ASNH_MYCTO Putative asparagine synthetase [glutamine-hydrolyzing] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=asnB PE=3 SV=1 27 389 5.0E-28
sp|P64248|ASNH_MYCBO Putative asparagine synthetase [glutamine-hydrolyzing] OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=asnB PE=1 SV=1 27 389 5.0E-28
sp|P42113|ASNH_BACSU Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Bacillus subtilis (strain 168) GN=asnH PE=1 SV=2 23 465 1.0E-24
sp|P0DJQ7|BLS_STRCL Carboxyethyl-arginine beta-lactam-synthase OS=Streptomyces clavuligerus GN=bls PE=1 SV=1 59 494 6.0E-11
sp|P0DJQ8|BLS_STRC2 Carboxyethyl-arginine beta-lactam-synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=bls PE=3 SV=1 59 494 6.0E-11
sp|Q9XB61|CARA_PECCC Carbapenam-3-carboxylate synthase OS=Pectobacterium carotovorum subsp. carotovorum GN=carA PE=1 SV=1 232 492 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0004066 asparagine synthase (glutamine-hydrolyzing) activity Yes
GO:0006529 asparagine biosynthetic process Yes
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009067 aspartate family amino acid biosynthetic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0046394 carboxylic acid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016884 carbon-nitrogen ligase activity, with glutamine as amido-N-donor No
GO:0006528 asparagine metabolic process No
GO:0016874 ligase activity No
GO:1901605 alpha-amino acid metabolic process No
GO:0009066 aspartate family amino acid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4770
MCGIFACHRHPDVSKFKPTALRLAKQIRHRGPDWSGSIISNNTILCHERLCIVGVESGAQPLTNADESLVLAVNG
EIYNHRLIRRHLKEVYHFKTHSDCEVIIPLYMEYGLDAPCHLDGMFSFVLYDKTQDRIVAARDPIGITTFYQGWS
SKEPGTVYFASELKSLFPVCDKIVAFPPGHVYDSKTDQTTRYFKPSWWDPAKAPSTPVDYKALRHALEKSVKKRL
MAEVPYGVLLSGGLDSSLVASIAQRETLRLKNKALAVNGDGEPHGNPDLGEGLVGIDDENNLDTVTYLPQLNSFS
IGLPGSPDNKAALEVAKFLGTKHHVMTFTIEDGLNALSDVIYHLETYDVTTIRASTPMYLLSRKIKAMGIKMVLS
GEGSDEIFGGYLYFHAAPDSTAFHEETVRRVKNLHLADCLRANKSTSAWGLEARVPFLDKEFLELSMNIDAREKM
ITKDRIEKYIIRKAFDTSDEPDEKPYLPESILWRQKEQFSDGVGYGWIDALKDNAELHVTDEMMKKPKAEWGDDV
PDTKEAYWYRTMFDEHFPAHCASTVMRWTPTWSQQSDPSGRAISTHVAKYDEAA*
Coding >Ophun1|4770
ATGTGTGGGATTTTCGCATGCCATCGTCATCCCGACGTCTCCAAGTTCAAGCCGACTGCGCTCCGGCTCGCAAAG
CAGATTCGCCATCGCGGGCCCGATTGGAGTGGGAGTATCATCTCCAACAACACGATCCTCTGCCATGAACGTCTT
TGCATTGTTGGCGTTGAGTCTGGCGCCCAGCCACTGACCAATGCCGACGAGTCGCTTGTCCTGGCCGTCAATGGC
GAGATATACAACCATCGTCTCATCCGGAGGCATCTCAAGGAGGTGTACCATTTCAAGACGCACTCTGACTGCGAG
GTTATCATCCCGTTGTATATGGAATATGGTCTCGATGCGCCTTGTCATCTCGACGGCATGTTTTCCTTCGTCTTG
TATGACAAGACTCAGGATCGCATTGTAGCCGCTCGCGACCCCATCGGCATCACCACCTTCTACCAGGGCTGGTCG
TCCAAGGAGCCCGGAACCGTCTACTTTGCCTCGGAGCTCAAGTCGCTGTTCCCCGTCTGTGACAAGATTGTTGCT
TTCCCGCCTGGACACGTCTATGACTCCAAGACGGACCAGACGACTAGGTATTTCAAGCCGTCGTGGTGGGATCCG
GCCAAGGCCCCGTCGACGCCAGTCGACTACAAGGCTCTGCGTCACGCACTGGAGAAGTCGGTCAAGAAGCGGCTC
ATGGCCGAGGTCCCGTACGGCGTCTTGCTGTCTGGCGGTCTGGACTCGAGCCTCGTTGCTTCCATCGCGCAGCGC
GAGACATTGCGCCTGAAGAACAAGGCGCTGGCAGTCAACGGCGATGGCGAGCCTCATGGCAACCCGGACCTGGGT
GAGGGGTTGGTTGGTATCGACGACGAGAACAACCTCGACACCGTCACGTATCTGCCTCAGCTCAACTCGTTTTCC
ATCGGTCTCCCCGGCTCTCCCGACAACAAGGCGGCTCTCGAGGTGGCCAAGTTTCTCGGCACCAAGCACCACGTC
ATGACGTTTACCATCGAGGACGGGCTCAATGCGCTCTCGGACGTCATCTACCATCTCGAGACGTACGACGTGACG
ACGATCCGCGCCTCGACGCCCATGTACCTGCTGTCTCGCAAGATCAAGGCCATGGGCATCAAGATGGTGCTCAGC
GGCGAGGGCAGCGACGAAATCTTTGGCGGCTATCTGTACTTTCATGCGGCGCCCGACAGCACCGCCTTCCACGAG
GAGACTGTTCGCCGAGTCAAGAACTTGCATCTGGCCGACTGTCTGCGCGCCAACAAGTCGACGTCTGCCTGGGGT
CTCGAGGCTCGCGTGCCCTTCCTGGACAAGGAGTTCCTTGAACTCAGCATGAATATTGATGCGCGGGAGAAGATG
ATCACCAAGGATCGAATCGAAAAGTACATTATCCGCAAGGCATTCGATACGAGCGACGAGCCTGACGAGAAGCCG
TATCTGCCGGAGTCGATCCTGTGGCGACAAAAGGAACAGTTCTCGGACGGCGTCGGTTACGGCTGGATCGACGCG
CTGAAGGACAACGCCGAGCTGCATGTGACGGACGAGATGATGAAGAAGCCCAAAGCGGAATGGGGCGACGACGTG
CCGGATACCAAGGAGGCCTACTGGTATCGCACCATGTTTGACGAGCACTTCCCGGCGCACTGCGCATCGACGGTT
ATGCGCTGGACGCCGACCTGGTCCCAGCAGTCGGATCCCAGCGGCAGGGCCATCTCGACCCACGTTGCCAAGTAC
GACGAAGCCGCTTAA
Transcript >Ophun1|4770
ATGTGTGGGATTTTCGCATGCCATCGTCATCCCGACGTCTCCAAGTTCAAGCCGACTGCGCTCCGGCTCGCAAAG
CAGATTCGCCATCGCGGGCCCGATTGGAGTGGGAGTATCATCTCCAACAACACGATCCTCTGCCATGAACGTCTT
TGCATTGTTGGCGTTGAGTCTGGCGCCCAGCCACTGACCAATGCCGACGAGTCGCTTGTCCTGGCCGTCAATGGC
GAGATATACAACCATCGTCTCATCCGGAGGCATCTCAAGGAGGTGTACCATTTCAAGACGCACTCTGACTGCGAG
GTTATCATCCCGTTGTATATGGAATATGGTCTCGATGCGCCTTGTCATCTCGACGGCATGTTTTCCTTCGTCTTG
TATGACAAGACTCAGGATCGCATTGTAGCCGCTCGCGACCCCATCGGCATCACCACCTTCTACCAGGGCTGGTCG
TCCAAGGAGCCCGGAACCGTCTACTTTGCCTCGGAGCTCAAGTCGCTGTTCCCCGTCTGTGACAAGATTGTTGCT
TTCCCGCCTGGACACGTCTATGACTCCAAGACGGACCAGACGACTAGGTATTTCAAGCCGTCGTGGTGGGATCCG
GCCAAGGCCCCGTCGACGCCAGTCGACTACAAGGCTCTGCGTCACGCACTGGAGAAGTCGGTCAAGAAGCGGCTC
ATGGCCGAGGTCCCGTACGGCGTCTTGCTGTCTGGCGGTCTGGACTCGAGCCTCGTTGCTTCCATCGCGCAGCGC
GAGACATTGCGCCTGAAGAACAAGGCGCTGGCAGTCAACGGCGATGGCGAGCCTCATGGCAACCCGGACCTGGGT
GAGGGGTTGGTTGGTATCGACGACGAGAACAACCTCGACACCGTCACGTATCTGCCTCAGCTCAACTCGTTTTCC
ATCGGTCTCCCCGGCTCTCCCGACAACAAGGCGGCTCTCGAGGTGGCCAAGTTTCTCGGCACCAAGCACCACGTC
ATGACGTTTACCATCGAGGACGGGCTCAATGCGCTCTCGGACGTCATCTACCATCTCGAGACGTACGACGTGACG
ACGATCCGCGCCTCGACGCCCATGTACCTGCTGTCTCGCAAGATCAAGGCCATGGGCATCAAGATGGTGCTCAGC
GGCGAGGGCAGCGACGAAATCTTTGGCGGCTATCTGTACTTTCATGCGGCGCCCGACAGCACCGCCTTCCACGAG
GAGACTGTTCGCCGAGTCAAGAACTTGCATCTGGCCGACTGTCTGCGCGCCAACAAGTCGACGTCTGCCTGGGGT
CTCGAGGCTCGCGTGCCCTTCCTGGACAAGGAGTTCCTTGAACTCAGCATGAATATTGATGCGCGGGAGAAGATG
ATCACCAAGGATCGAATCGAAAAGTACATTATCCGCAAGGCATTCGATACGAGCGACGAGCCTGACGAGAAGCCG
TATCTGCCGGAGTCGATCCTGTGGCGACAAAAGGAACAGTTCTCGGACGGCGTCGGTTACGGCTGGATCGACGCG
CTGAAGGACAACGCCGAGCTGCATGTGACGGACGAGATGATGAAGAAGCCCAAAGCGGAATGGGGCGACGACGTG
CCGGATACCAAGGAGGCCTACTGGTATCGCACCATGTTTGACGAGCACTTCCCGGCGCACTGCGCATCGACGGTT
ATGCGCTGGACGCCGACCTGGTCCCAGCAGTCGGATCCCAGCGGCAGGGCCATCTCGACCCACGTTGCCAAGTAC
GACGAAGCCGCTTAA
Gene >Ophun1|4770
ATGTGTGGGATTTTCGCATGCCATCGGTGCGTCCAATCGACTGCCAGAGAATATTGGAAAACAGCCGAAGAGAGG
ACCCCACTAACCACGTCCTTGCAGTCATCCCGACGTCTCCAAGTTCAAGCCGACTGCGCTCCGGCTCGCAAAGCA
GTATGTGATGCCCTGAGAGTGGGAGTCACGGGCACAATTGACTGGGATTCGACAGGATTCGCCATCGCGGGCCCG
ATTGGAGTGAGTCGACGGCCGTACGCGACGGAGACTCGAGACTGATGACGGAACAGGTGGGAGTATCATCTCCAA
CAACACGAGTACGCCCTCTGTCTACATTTCACCTGCGCGTCCACTGATGGCGTGAATTAGTCCTCTGCCATGAAC
GTCTTTGCATTGTTGGCGTTGGTTAGTTCTGCCCGACTGTCTTTGGACCGGCCTCGGCTGACGCGTGTCCAGAGT
CTGGCGCCCAGCCACTGACCAATGCCGACGAGTCGCTTGTCCTGGCCGTCAATGGCGAGATATACAACCATCGTC
TCATCCGGAGGCATCTCAAGGAGGTGTACCATTTCAAGACGCACTCTGACTGCGAGGTTATCATCCCGTTGGTTC
GTCGTCCCCTTGACGGTCGCGTCCTGTCCCGCCATTGTAGGGTCCTAATACGTTGCTCGTCAGTATATGGAATAT
GGTCTCGATGCGCCTTGTCATCTCGACGGCATGTTTTCCTTCGTCTTGTATGACAAGACTCAGGATCGCATTGTA
GCCGCTCGCGACCCCATCGGCATCACCACCTTCTACCAGGGCTGGTCGTCCAAGGAGCCCGGAACCGTCTACTTT
GCCTCGGAGCTCAAGTCGCTGTTCCCCGTCTGTGACAAGATTGTTGCTTTCCCGCCTGGACACGTCTATGACTCC
AAGACGGACCAGACGACTAGGTATTTCAAGCCGTCGTGGTGGGATCCGGCCAAGGCCCCGTCGACGCCAGTCGAC
TACAAGGCTCTGCGTCACGCACTGGAGAAGTCGGTCAAGAAGCGGCTCATGGCCGAGGTCCCGTACGGCGTCTTG
CTGTCTGGCGGTCTGGACTCGAGCCTCGTTGCTTCCATCGCGCAGCGCGAGACATTGCGCCTGAAGAACAAGGCG
CTGGCAGTCAACGGCGATGGCGAGCCTCATGGCAACCCGGACCTGGGTGAGGGGTTGGTTGGTATCGACGACGAG
AACAACCTCGACACCGTCACGTATCTGCCTCAGCTCAACTCGTTTTCCATCGGTCTCCCCGGCTCTCCCGACAAC
AAGGCGGCTCTCGAGGTGGCCAAGTTTCTCGGCACCAAGCACCACGTCATGACGTTTACCATCGAGGACGGGCTC
AATGCGCTCTCGGACGTCATCTACCATCTCGAGACGTACGACGTGACGACGATCCGCGCCTCGACGCCCATGTAC
CTGCTGTCTCGCAAGATCAAGGCCATGGGCATCAAGATGGTGCTCAGCGGCGAGGGCAGCGACGAAATCTTTGGC
GGCTATCTGTACTTTCATGCGGCGCCCGACAGCACCGCCTTCCACGAGGAGACTGTTCGCCGAGTCAAGAACTTG
CATCTGGCCGACTGTCTGCGCGCCAACAAGTCGACGTCTGCCTGGGGTCTCGAGGCTCGCGTGCCCTTCCTGGAC
AAGGAGGTGGGTTCGGAGGGAAACAGGCTGGTTATGGGCTGTGGATGAGTGCTGACGTGAAGTGACCAGTTCCTT
GAACTCAGCATGAATATTGATGCGCGGGAGAAGATGATCACCAAGGATCGAATCGAAAAGTACATTATCCGCAAG
GCATTCGATACGAGCGACGAGCCTGACGAGAAGCCGTATCTGCCGGAGTCGATCCTGTGGCGACAAAAGGAACAG
TTCTCGGACGGCGTCGGTTACGGCTGGATCGACGCGCTGAAGGACAACGCCGAGCTGCATGTGACGGACGAGATG
ATGAAGAAGCCCAAAGCGGAATGGGGCGACGACGTGCCGGATACCAAGGAGGCCTACTGGTATCGCACCATGTTT
GACGAGCACTTCCCGGCGCACTGCGCATCGACGGTTATGCGCTGGACGCCGACCTGGTCCCAGCAGTCGGATCCC
AGCGGCAGGGCCATCTCGACCCACGTTGCCAAGTACGACGAAGCCGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail