Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4769
Gene name
LocationContig_448:9402..10700
Strand-
Gene length (bp)1298
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01459 Porin_3 Eukaryotic porin 4.3E-08 4 63
PF01459 Porin_3 Eukaryotic porin 2.4E-53 128 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07144|VDAC_NEUCR Mitochondrial outer membrane protein porin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7H23.070 PE=2 SV=1 1 346 4.0E-143
sp|P83781|VDAC_CANAL Mitochondrial outer membrane protein porin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POR1 PE=1 SV=2 1 345 3.0E-66
sp|Q9P544|VDAC_SCHPO Probable mitochondrial outer membrane protein porin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1635.01 PE=3 SV=1 131 345 7.0E-54
sp|P04840|VDAC1_YEAST Mitochondrial outer membrane protein porin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR1 PE=1 SV=4 131 346 4.0E-41
sp|P40478|VDAC2_YEAST Mitochondrial outer membrane protein porin 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR2 PE=1 SV=1 131 345 3.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07144|VDAC_NEUCR Mitochondrial outer membrane protein porin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7H23.070 PE=2 SV=1 1 346 4.0E-143
sp|P83781|VDAC_CANAL Mitochondrial outer membrane protein porin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POR1 PE=1 SV=2 1 345 3.0E-66
sp|Q9P544|VDAC_SCHPO Probable mitochondrial outer membrane protein porin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1635.01 PE=3 SV=1 131 345 7.0E-54
sp|P04840|VDAC1_YEAST Mitochondrial outer membrane protein porin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR1 PE=1 SV=4 131 346 4.0E-41
sp|P40478|VDAC2_YEAST Mitochondrial outer membrane protein porin 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR2 PE=1 SV=1 131 345 3.0E-32
sp|Q94920|VDAC_DROME Voltage-dependent anion-selective channel OS=Drosophila melanogaster GN=porin PE=1 SV=3 131 346 5.0E-31
sp|P21796|VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens GN=VDAC1 PE=1 SV=2 131 346 8.0E-30
sp|Q9Z2L0|VDAC1_RAT Voltage-dependent anion-selective channel protein 1 OS=Rattus norvegicus GN=Vdac1 PE=1 SV=4 131 346 1.0E-29
sp|Q9TT15|VDAC1_RABIT Voltage-dependent anion-selective channel protein 1 OS=Oryctolagus cuniculus GN=VDAC1 PE=2 SV=3 131 346 1.0E-29
sp|P45879|VDAC1_BOVIN Voltage-dependent anion-selective channel protein 1 OS=Bos taurus GN=VDAC1 PE=1 SV=3 131 346 1.0E-29
sp|Q60932|VDAC1_MOUSE Voltage-dependent anion-selective channel protein 1 OS=Mus musculus GN=Vdac1 PE=1 SV=3 131 346 1.0E-29
sp|Q9MZ16|VDAC1_PIG Voltage-dependent anion-selective channel protein 1 OS=Sus scrofa GN=VDAC1 PE=2 SV=3 131 346 2.0E-29
sp|Q9TT13|VDAC3_RABIT Voltage-dependent anion-selective channel protein 3 OS=Oryctolagus cuniculus GN=VDAC3 PE=2 SV=1 126 346 7.0E-28
sp|Q60931|VDAC3_MOUSE Voltage-dependent anion-selective channel protein 3 OS=Mus musculus GN=Vdac3 PE=1 SV=1 126 346 9.0E-28
sp|P81004|VDAC2_XENLA Voltage-dependent anion-selective channel protein 2 OS=Xenopus laevis GN=vdac2 PE=1 SV=1 131 346 1.0E-27
sp|Q9MZ13|VDAC3_BOVIN Voltage-dependent anion-selective channel protein 3 OS=Bos taurus GN=VDAC3 PE=2 SV=1 126 346 1.0E-27
sp|Q9MZ15|VDAC2_PIG Voltage-dependent anion-selective channel protein 2 OS=Sus scrofa GN=VDAC2 PE=2 SV=1 127 346 2.0E-27
sp|Q60930|VDAC2_MOUSE Voltage-dependent anion-selective channel protein 2 OS=Mus musculus GN=Vdac2 PE=1 SV=2 127 346 2.0E-27
sp|P68002|VDAC2_BOVIN Voltage-dependent anion-selective channel protein 2 OS=Bos taurus GN=VDAC2 PE=2 SV=2 127 346 3.0E-27
sp|P81155|VDAC2_RAT Voltage-dependent anion-selective channel protein 2 OS=Rattus norvegicus GN=Vdac2 PE=1 SV=2 127 346 3.0E-27
sp|P68003|VDAC2_RABIT Voltage-dependent anion-selective channel protein 2 OS=Oryctolagus cuniculus GN=VDAC2 PE=2 SV=1 127 346 3.0E-27
sp|Q9R1Z0|VDAC3_RAT Voltage-dependent anion-selective channel protein 3 OS=Rattus norvegicus GN=Vdac3 PE=1 SV=2 126 346 4.0E-27
sp|Q9Y277|VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 126 346 8.0E-27
sp|P45880|VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 127 346 8.0E-27
sp|P82013|VDAC2_MELGA Voltage-dependent anion-selective channel protein 2 OS=Meleagris gallopavo GN=VDAC2 PE=1 SV=1 131 346 2.0E-26
sp|Q29380|VDAC3_PIG Voltage-dependent anion-selective channel protein 3 OS=Sus scrofa GN=VDAC3 PE=2 SV=2 126 346 2.0E-26
sp|Q5R7V4|VDAC3_PONAB Voltage-dependent anion-selective channel protein 3 OS=Pongo abelii GN=VDAC3 PE=2 SV=1 128 346 5.0E-25
sp|Q21752|VDAC_CAEEL Probable voltage-dependent anion-selective channel OS=Caenorhabditis elegans GN=vdac-1 PE=3 SV=2 131 346 7.0E-20
sp|Q84P97|VDAC5_ORYSJ Mitochondrial outer membrane protein porin 5 OS=Oryza sativa subsp. japonica GN=VDAC5 PE=2 SV=1 144 334 9.0E-12
sp|Q6K548|VDAC1_ORYSJ Mitochondrial outer membrane protein porin 1 OS=Oryza sativa subsp. japonica GN=VDAC1 PE=1 SV=3 152 336 1.0E-08
sp|Q6L5I5|VDAC2_ORYSJ Mitochondrial outer membrane protein porin 2 OS=Oryza sativa subsp. japonica GN=VDAC2 PE=2 SV=1 144 346 2.0E-08
sp|Q9FJX3|VDAC2_ARATH Mitochondrial outer membrane protein porin 2 OS=Arabidopsis thaliana GN=VDAC2 PE=1 SV=1 144 334 3.0E-07
sp|Q9FKM2|VDAC4_ARATH Mitochondrial outer membrane protein porin 4 OS=Arabidopsis thaliana GN=VDAC4 PE=1 SV=1 133 340 9.0E-07
sp|Q9SRH5|VDAC1_ARATH Mitochondrial outer membrane protein porin 1 OS=Arabidopsis thaliana GN=VDAC1 PE=1 SV=3 194 335 1.0E-06
sp|Q10S27|VDAC6_ORYSJ Mitochondrial outer membrane protein porin 6 OS=Oryza sativa subsp. japonica GN=VDAC6 PE=2 SV=1 144 328 2.0E-06
sp|P42057|VDAC_MAIZE Outer plastidial membrane protein porin OS=Zea mays GN=POR1 PE=2 SV=1 132 346 3.0E-06
sp|Q7F4F8|VDAC3_ORYSJ Mitochondrial outer membrane protein porin 3 OS=Oryza sativa subsp. japonica GN=VDAC3 PE=2 SV=1 173 346 7.0E-06
sp|Q0JJV1|VDAC4_ORYSJ Mitochondrial outer membrane protein porin 4 OS=Oryza sativa subsp. japonica GN=VDAC4 PE=3 SV=3 194 346 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005741 mitochondrial outer membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0031966 mitochondrial membrane No
GO:0051234 establishment of localization No
GO:0031090 organelle membrane No
GO:0031968 organelle outer membrane No
GO:0016020 membrane No
GO:0019867 outer membrane No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0098588 bounding membrane of organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4269
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4645
Ophiocordyceps australis map64 (Brazil) OphauB2|7244
Ophiocordyceps camponoti-floridani Ophcf2|00711
Ophiocordyceps camponoti-rufipedis Ophun1|4769 (this protein)
Ophiocordyceps kimflemingae Ophio5|6194
Ophiocordyceps subramaniannii Hirsu2|8727

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4769
MPVPAFSDLAKPANDLLNKDFYHLSATTFEFKDTAPNGVAFKIAGKSSHDKMTSASIEGKYVDKPTGIPPRRRDR
PVTRPRPAKRALRRNLVVGCVSGILGRGPDSPCEMAAIMGIPGRRTALLMICNYAGLTLTQTWNTANSLDTKLEV
SDSLAKGLKLEGLFNFLPATAARNAKFNLMFRQPNFHGRAFFDLLRGPTANVDAVIGHEGFLAGASAGYDVNKAA
VTAYSAAVGYSVPSYSAAITATDNLSTFSACYYHKVNSQVEAGAKAVWNSKTGNAVGLEVAGKYRIDPVSFAKVK
INDRGIAALAYNVLLREGVTLGLGGSFDTQKLDQATHKLGASFTFEG*
Coding >Ophun1|4769
ATGCCTGTTCCCGCCTTTTCAGACCTTGCCAAGCCGGCAAACGATCTCCTCAACAAGGACTTCTACCACCTGTCG
GCCACGACTTTCGAGTTCAAGGACACGGCTCCCAATGGCGTCGCCTTCAAGATCGCCGGAAAGTCGAGCCACGAC
AAGATGACGTCCGCCTCGATCGAGGGCAAATACGTCGACAAACCAACCGGTATTCCCCCCAGACGTCGTGACCGT
CCCGTGACCCGTCCCCGTCCCGCAAAGCGCGCACTGCGGCGGAACCTCGTCGTCGGCTGCGTGTCGGGAATCCTG
GGCCGGGGCCCGGACTCGCCCTGCGAAATGGCGGCCATCATGGGCATTCCTGGTCGCAGGACAGCTTTGCTGATG
ATTTGTAACTATGCAGGCTTGACGTTGACGCAGACGTGGAATACGGCCAACTCGCTCGACACCAAGCTCGAGGTC
AGCGACTCGCTGGCAAAGGGCCTTAAGCTTGAAGGCCTCTTCAACTTCTTGCCCGCCACGGCTGCCCGCAACGCA
AAGTTCAACCTCATGTTCCGCCAGCCCAACTTCCACGGCCGCGCTTTCTTCGATCTCCTCCGCGGCCCGACGGCA
AACGTCGACGCCGTCATCGGCCATGAGGGTTTCCTGGCCGGTGCCAGTGCCGGATACGACGTCAACAAGGCGGCC
GTCACCGCTTACAGCGCCGCCGTCGGTTACTCTGTGCCTTCCTACAGCGCCGCCATCACCGCCACCGACAACCTG
AGCACCTTTTCCGCCTGCTACTACCACAAGGTTAACAGCCAGGTCGAGGCCGGCGCCAAGGCAGTCTGGAACTCC
AAGACGGGCAATGCCGTCGGTCTCGAGGTGGCTGGCAAGTACCGCATCGACCCCGTGTCCTTTGCCAAGGTCAAG
ATCAACGACCGTGGCATTGCCGCCCTCGCCTACAACGTGCTCCTCCGCGAAGGCGTCACCCTCGGCCTCGGCGGC
TCCTTTGACACCCAGAAGCTCGACCAGGCGACGCACAAGCTCGGCGCCAGCTTCACCTTTGAAGGCTAG
Transcript >Ophun1|4769
ATGCCTGTTCCCGCCTTTTCAGACCTTGCCAAGCCGGCAAACGATCTCCTCAACAAGGACTTCTACCACCTGTCG
GCCACGACTTTCGAGTTCAAGGACACGGCTCCCAATGGCGTCGCCTTCAAGATCGCCGGAAAGTCGAGCCACGAC
AAGATGACGTCCGCCTCGATCGAGGGCAAATACGTCGACAAACCAACCGGTATTCCCCCCAGACGTCGTGACCGT
CCCGTGACCCGTCCCCGTCCCGCAAAGCGCGCACTGCGGCGGAACCTCGTCGTCGGCTGCGTGTCGGGAATCCTG
GGCCGGGGCCCGGACTCGCCCTGCGAAATGGCGGCCATCATGGGCATTCCTGGTCGCAGGACAGCTTTGCTGATG
ATTTGTAACTATGCAGGCTTGACGTTGACGCAGACGTGGAATACGGCCAACTCGCTCGACACCAAGCTCGAGGTC
AGCGACTCGCTGGCAAAGGGCCTTAAGCTTGAAGGCCTCTTCAACTTCTTGCCCGCCACGGCTGCCCGCAACGCA
AAGTTCAACCTCATGTTCCGCCAGCCCAACTTCCACGGCCGCGCTTTCTTCGATCTCCTCCGCGGCCCGACGGCA
AACGTCGACGCCGTCATCGGCCATGAGGGTTTCCTGGCCGGTGCCAGTGCCGGATACGACGTCAACAAGGCGGCC
GTCACCGCTTACAGCGCCGCCGTCGGTTACTCTGTGCCTTCCTACAGCGCCGCCATCACCGCCACCGACAACCTG
AGCACCTTTTCCGCCTGCTACTACCACAAGGTTAACAGCCAGGTCGAGGCCGGCGCCAAGGCAGTCTGGAACTCC
AAGACGGGCAATGCCGTCGGTCTCGAGGTGGCTGGCAAGTACCGCATCGACCCCGTGTCCTTTGCCAAGGTCAAG
ATCAACGACCGTGGCATTGCCGCCCTCGCCTACAACGTGCTCCTCCGCGAAGGCGTCACCCTCGGCCTCGGCGGC
TCCTTTGACACCCAGAAGCTCGACCAGGCGACGCACAAGCTCGGCGCCAGCTTCACCTTTGAAGGCTAG
Gene >Ophun1|4769
ATGCCTGTTCCCGCCTTTTCAGACCTTGCCAAGCCGGCAAACGATGTGCGTTGCTCTATCACTTACTGAAGGAAG
CAACGGAGTAGATGCTGACGCTTCCTCTCTCAACAGCTCCTCAACAAGGACTTCTACCACCTGTCGGCCACGACT
TTCGAGTTCAAGGACACGGCTCCCAATGGCGTCGCCTTCAAGATCGCCGGAAAGTCGAGCCACGACAAGATGACG
TCCGCCTCGGTACGCGAATCAACTACATCCTGACCAGCCGCTCAGACTGACAAGCCGCCAGATCGAGGGCAAATA
CGTCGACAAACCAACCGGTATTCCCCCCAGACGTCGTGACCGTCCCGTGACCCGTCCCCGTCCCGCAAAGCGCGC
ACTGCGGCGGAACCTCGTCGTCGGCTGCGTGTCGGGAATCCTGGGCCGGGGCCCGGACTCGCCCTGCGAAATGGC
GGCCATCATGGGCATTCCTGGTCGCAGGACAGCTTTGCTGATGATTTGTAACTATGCAGGCTTGACGTTGACGCA
GACGTGGAATACGGCCAACTCGCTCGACACCAAGCTCGAGGTCAGCGACTCGCTGGCAAAGGGCCTTAAGCTTGA
AGGCCTCTTCAACTTCTTGCCCGCCACGGCTGCCCGCAACGCAAAGTTCAACCTCATGTTCCGCCAGCCCAACTT
CCACGGCCGCGCTTTCTTCGATCTCCTCCGCGGCCCGACGGCAAACGTCGACGCCGTCATCGGCCATGAGGGTTT
CCTGGCCGGTGCCAGTGCCGGATACGACGTCAACAAGGCGGCCGTCACCGCTTACAGCGCCGCCGTCGGTTACTC
TGTGCCTTCCTACAGCGCCGCCATCACCGCCACCGACAACCTGAGCACCTTTTCCGCCTGCTACTACCACAAGGT
TAACAGCCAGGTCGAGGCCGGCGCCAAGGCAGTCTGGAACTCCAAGACGGGCAATGCCGTCGGTCTCGAGGTGGC
TGGCAAGTACCGCATCGACCCCGTGTCCTTTGCCAAGGTGGGCTCCTGTCTTTTGCTCTGTTTCTCTCTGCAACC
ACGCCCGCTGACAAGGAGGATTCGTCGCCCACAGGTCAAGATCAACGACCGTGGCATTGCCGCCCTCGCCTACAA
CGTGCTCCTCCGCGAAGGCGTCACCCTCGGCCTCGGCGGCTCCTTTGACACCCAGAAGCTCGACCAGGCGACGCA
CAAGGTACGTCATTGCCCGACTGCGGATTTAGGTGGTCAACAGCTGACGACTGCATTTCATCACCCAGCTCGGCG
CCAGCTTCACCTTTGAAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail