Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4758
Gene name
LocationContig_446:12444..13738
Strand-
Gene length (bp)1294
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 3.2E-10 275 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S0P8|CSN4_NEUCR COP9 signalosome complex subunit 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-4 PE=1 SV=1 5 413 4.0E-148
sp|Q9C467|CSN4_EMENI COP9 signalosome complex subunit 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnD PE=1 SV=2 4 397 1.0E-108
sp|Q54B82|CSN4_DICDI COP9 signalosome complex subunit 4 OS=Dictyostelium discoideum GN=csn4 PE=2 SV=1 58 410 6.0E-84
sp|Q3SZA0|CSN4_BOVIN COP9 signalosome complex subunit 4 OS=Bos taurus GN=COPS4 PE=2 SV=1 47 410 2.0E-79
sp|O88544|CSN4_MOUSE COP9 signalosome complex subunit 4 OS=Mus musculus GN=Cops4 PE=1 SV=1 47 410 4.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S0P8|CSN4_NEUCR COP9 signalosome complex subunit 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-4 PE=1 SV=1 5 413 4.0E-148
sp|Q9C467|CSN4_EMENI COP9 signalosome complex subunit 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnD PE=1 SV=2 4 397 1.0E-108
sp|Q54B82|CSN4_DICDI COP9 signalosome complex subunit 4 OS=Dictyostelium discoideum GN=csn4 PE=2 SV=1 58 410 6.0E-84
sp|Q3SZA0|CSN4_BOVIN COP9 signalosome complex subunit 4 OS=Bos taurus GN=COPS4 PE=2 SV=1 47 410 2.0E-79
sp|O88544|CSN4_MOUSE COP9 signalosome complex subunit 4 OS=Mus musculus GN=Cops4 PE=1 SV=1 47 410 4.0E-79
sp|A7Y521|CSN4_PIG COP9 signalosome complex subunit 4 OS=Sus scrofa GN=COPS4 PE=2 SV=1 47 410 7.0E-79
sp|Q4R5E6|CSN4_MACFA COP9 signalosome complex subunit 4 OS=Macaca fascicularis GN=COPS4 PE=2 SV=1 47 410 7.0E-79
sp|Q9BT78|CSN4_HUMAN COP9 signalosome complex subunit 4 OS=Homo sapiens GN=COPS4 PE=1 SV=1 47 410 7.0E-79
sp|Q68FS2|CSN4_RAT COP9 signalosome complex subunit 4 OS=Rattus norvegicus GN=Cops4 PE=1 SV=1 47 410 8.0E-79
sp|Q5R648|CSN4_PONAB COP9 signalosome complex subunit 4 OS=Pongo abelii GN=COPS4 PE=2 SV=1 47 410 1.0E-78
sp|Q6P0H6|CSN4_DANRE COP9 signalosome complex subunit 4 OS=Danio rerio GN=cops4 PE=2 SV=1 47 410 1.0E-77
sp|Q8L5U0|CSN4_ARATH COP9 signalosome complex subunit 4 OS=Arabidopsis thaliana GN=CSN4 PE=1 SV=2 52 404 8.0E-67
sp|Q9V345|CSN4_DROME COP9 signalosome complex subunit 4 OS=Drosophila melanogaster GN=CSN4 PE=1 SV=1 21 409 6.0E-65
sp|Q9N359|CSN4_CAEEL COP9 signalosome complex subunit 4 OS=Caenorhabditis elegans GN=csn-4 PE=1 SV=1 50 409 7.0E-48
sp|Q54UJ0|PSD12_DICDI 26S proteasome non-ATPase regulatory subunit 12 OS=Dictyostelium discoideum GN=psmD12 PE=2 SV=1 91 405 9.0E-08
sp|Q9UTM3|RPN5_SCHPO 26S proteasome regulatory subunit rpn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn501 PE=1 SV=1 91 404 2.0E-07
sp|Q9FIB6|PS12A_ARATH 26S proteasome non-ATPase regulatory subunit 12 homolog A OS=Arabidopsis thaliana GN=RPN5A PE=1 SV=1 196 404 1.0E-06
sp|Q8VWK0|PS12B_ARATH 26S proteasome non-ATPase regulatory subunit 12 homolog B OS=Arabidopsis thaliana GN=RPN5B PE=1 SV=1 196 404 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2980
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5969
Ophiocordyceps australis map64 (Brazil) OphauB2|2295
Ophiocordyceps camponoti-floridani Ophcf2|07201
Ophiocordyceps camponoti-rufipedis Ophun1|4758 (this protein)
Ophiocordyceps kimflemingae Ophio5|7561
Ophiocordyceps subramaniannii Hirsu2|5101

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4758
MAAPTAKVADALAAAESAPNDKKPTLYTTLLTSIQTLSTPSTAATDLNAIADSFFAASLGVVSTRALLVTFIKAL
ESLGDDSLTMAVGERTLSTLAGQPSSFQDATAALCQLVASAQEAAEDFAGAARTLASVPLDGSQRELTDEDKARV
WVRIVRDLLEVDDATTAETYVNKLKNIMHNVSDADLSLHFRLSQARIQDAQRDFLPASQRYHEISFLPTVAEDER
LHTLAMAVKCAVLAPAGPSRSRALARLYKDDRAAGLDEFAILEKMFLDRLLAKDEADKFAEGLAPHQLATTSDGS
TVLAKAVVEHNLRAASRLYANIRFDDLGHLLGLDAVRAEETTARMMEQGRLMGRIDQLGSTVFFDVGDAGDGVVV
SGGELRRWDANVEGLCEEVERITNALQREFPEFVAANLVV*
Coding >Ophun1|4758
ATGGCGGCCCCTACCGCCAAGGTAGCCGACGCCCTCGCAGCAGCAGAATCAGCCCCAAACGACAAGAAACCCACC
CTCTACACAACCCTCCTAACCTCCATCCAAACCCTCTCGACCCCGTCCACAGCAGCAACAGACCTCAACGCCATC
GCAGACTCCTTCTTCGCCGCATCTCTCGGAGTGGTCTCCACGCGCGCCCTCCTGGTAACCTTCATCAAAGCCCTC
GAATCCCTCGGCGACGATAGCCTCACCATGGCCGTTGGGGAGCGCACCTTGTCCACGTTGGCAGGCCAACCCTCT
TCCTTTCAAGATGCCACGGCCGCGCTATGCCAGCTCGTCGCTTCGGCGCAGGAAGCAGCCGAGGATTTCGCTGGC
GCGGCGAGGACCTTGGCTTCTGTGCCGCTCGATGGGTCGCAGCGGGAGTTGACGGACGAGGACAAGGCGAGGGTT
TGGGTGCGGATCGTGCGGGATTTACTCGAAGTTGACGATGCGACGACGGCGGAAACTTACGTCAACAAGCTGAAG
AATATCATGCACAACGTTTCCGACGCAGATTTATCCCTTCACTTTCGTCTCTCGCAGGCTCGCATCCAGGACGCT
CAGCGCGACTTCCTACCCGCCTCGCAACGATACCACGAAATCAGCTTCCTGCCCACCGTCGCCGAGGACGAGAGG
CTGCACACGCTGGCCATGGCCGTCAAGTGTGCCGTCCTCGCGCCCGCCGGACCGTCGCGCAGCCGGGCCCTCGCC
CGTCTGTACAAGGATGATCGGGCGGCGGGGCTGGACGAGTTTGCCATCTTGGAGAAGATGTTTCTCGATAGGTTG
CTTGCGAAGGATGAGGCGGATAAGTTTGCTGAGGGGTTGGCGCCGCATCAGCTTGCCACCACGTCGGATGGATCT
ACCGTGTTGGCCAAGGCCGTGGTCGAGCATAACCTCCGCGCAGCGTCCCGACTGTACGCCAACATCCGCTTCGAC
GATCTGGGCCACCTCCTCGGTCTGGACGCCGTGAGGGCGGAGGAGACGACGGCCCGGATGATGGAGCAGGGGAGG
TTGATGGGACGGATCGATCAGCTGGGCAGCACCGTCTTCTTCGACGTTGGCGACGCGGGCGACGGTGTGGTTGTT
TCGGGGGGGGAGTTGCGCAGGTGGGACGCCAACGTTGAGGGGTTGTGCGAGGAGGTTGAGCGCATCACCAATGCG
TTGCAGAGGGAGTTTCCGGAGTTTGTGGCGGCGAATCTGGTGGTTTAG
Transcript >Ophun1|4758
ATGGCGGCCCCTACCGCCAAGGTAGCCGACGCCCTCGCAGCAGCAGAATCAGCCCCAAACGACAAGAAACCCACC
CTCTACACAACCCTCCTAACCTCCATCCAAACCCTCTCGACCCCGTCCACAGCAGCAACAGACCTCAACGCCATC
GCAGACTCCTTCTTCGCCGCATCTCTCGGAGTGGTCTCCACGCGCGCCCTCCTGGTAACCTTCATCAAAGCCCTC
GAATCCCTCGGCGACGATAGCCTCACCATGGCCGTTGGGGAGCGCACCTTGTCCACGTTGGCAGGCCAACCCTCT
TCCTTTCAAGATGCCACGGCCGCGCTATGCCAGCTCGTCGCTTCGGCGCAGGAAGCAGCCGAGGATTTCGCTGGC
GCGGCGAGGACCTTGGCTTCTGTGCCGCTCGATGGGTCGCAGCGGGAGTTGACGGACGAGGACAAGGCGAGGGTT
TGGGTGCGGATCGTGCGGGATTTACTCGAAGTTGACGATGCGACGACGGCGGAAACTTACGTCAACAAGCTGAAG
AATATCATGCACAACGTTTCCGACGCAGATTTATCCCTTCACTTTCGTCTCTCGCAGGCTCGCATCCAGGACGCT
CAGCGCGACTTCCTACCCGCCTCGCAACGATACCACGAAATCAGCTTCCTGCCCACCGTCGCCGAGGACGAGAGG
CTGCACACGCTGGCCATGGCCGTCAAGTGTGCCGTCCTCGCGCCCGCCGGACCGTCGCGCAGCCGGGCCCTCGCC
CGTCTGTACAAGGATGATCGGGCGGCGGGGCTGGACGAGTTTGCCATCTTGGAGAAGATGTTTCTCGATAGGTTG
CTTGCGAAGGATGAGGCGGATAAGTTTGCTGAGGGGTTGGCGCCGCATCAGCTTGCCACCACGTCGGATGGATCT
ACCGTGTTGGCCAAGGCCGTGGTCGAGCATAACCTCCGCGCAGCGTCCCGACTGTACGCCAACATCCGCTTCGAC
GATCTGGGCCACCTCCTCGGTCTGGACGCCGTGAGGGCGGAGGAGACGACGGCCCGGATGATGGAGCAGGGGAGG
TTGATGGGACGGATCGATCAGCTGGGCAGCACCGTCTTCTTCGACGTTGGCGACGCGGGCGACGGTGTGGTTGTT
TCGGGGGGGGAGTTGCGCAGGTGGGACGCCAACGTTGAGGGGTTGTGCGAGGAGGTTGAGCGCATCACCAATGCG
TTGCAGAGGGAGTTTCCGGAGTTTGTGGCGGCGAATCTGGTGGTTTAG
Gene >Ophun1|4758
ATGGCGGCCCCTACCGCCAAGGTAGCCGACGCCCTCGCAGCAGCAGAATCAGCCCCAAACGACAAGAAACCCACC
CTCTACACAACCCTCCTAACCTCCATCCAAACCCTCTCGACCCCGTCCACAGCAGCAACAGACCTCAACGCCATC
GCAGACTCCTTCTTCGCCGCATCTCTCGGAGTGGTCTCCACGCGCGCCCTCCTGGTAACCTTCATCAAAGCCCTC
GAATCCCTCGGCGACGATAGCCTCACCATGGCCGTTGGGGAGCGCACCTTGTCCACGTTGGCAGGCCAACCCTCT
TCCTTTCAAGATGCCACGGCCGCGCTATGCCAGCTCGTCGCTTCGGCGCAGGAAGCAGCCGAGGATTTCGCTGGC
GCGGCGAGGACCTTGGCTTCTGTGCCGCTCGATGGGTCGCAGCGGGAGTTGACGGACGAGGACAAGGCGAGGGTT
TGGGTGCGGATCGTGCGGGATTTACTCGAAGTTGACGATGCGACGACGGCGGAAACTTACGTCAACAAGCTGAAG
AATATCATGCACAACGTTTCCGACGCAGATTTATCCCTTCACTTTCGTCTCTCGCAGGCTCGCATCCAGGACGCT
CAGCGCGACTTCCTACCCGCCTCGCAACGATACCACGAAATCAGCTTCCTGCCCACCGTCGCCGAGGACGAGAGG
CTGCACACGCTGGCCATGGCCGTCAAGTGTGCCGTCCTCGCGCCCGCCGGACCGTCGCGCAGCCGGGCCCTCGCC
CGTCTGTACAAGGATGATCGGGCGGCGGGGCTGGACGAGTTTGCCATCTTGGAGAAGATGTTTCTCGATAGGTTG
CTTGCGAAGGATGAGGCGGATAAGTTTGCTGAGGGGTTGGCGCCGCATCAGCTTGCCACCACGTCGGATGGATCT
ACCGTGTTGGCCAAGGCCGTGGTCGAGCATAACCTCCGCGCAGCGTCCCGACTGTACGCCAACATCCGCTTCGAC
GATCTGGGCCACCTCCTCGGTCTGGACGCCGTGAGGGCGGAGGAGACGACGGCCCGGATGATGGAGCAGGGGAGG
TTGATGGGACGGATCGATCAGCTGGGCAGCACCGTCTTCTTCGACGTTGGCGACGCGGGCGACGGTGTGGTTGTT
TCGGGGGGGGAGTTGCGCAGGTGGGACGCCAACGTTGAGGGGTTGTGCGAGGAGGTTGAGCGCATCACCAATGCG
TTGCAGAGGGAGTTTCCGGTGAGTTTTGGGGTTGAGTGCGAGGGGGCTTTGCTGACGGGTGTAGGAGTTTGTGGC
GGCGAATCTGGTGGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail