Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4757
Gene name
LocationContig_446:6651..10666
Strand+
Gene length (bp)4015
Transcript length (bp)3540
Coding sequence length (bp)3540
Protein length (aa) 1180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14027 Questin_oxidase Questin oxidase-like 3.8E-69 61 369
PF03215 Rad17 Rad17 P-loop domain 5.3E-23 535 710

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50531|RAD17_SCHPO Checkpoint protein rad17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad17 PE=1 SV=1 535 987 1.0E-37
sp|Q6NXW6|RAD17_MOUSE Cell cycle checkpoint protein RAD17 OS=Mus musculus GN=Rad17 PE=1 SV=2 537 1002 2.0E-36
sp|Q9XT62|RAD17_CHLAE Cell cycle checkpoint protein RAD17 OS=Chlorocebus aethiops GN=RAD17 PE=1 SV=1 540 995 2.0E-35
sp|Q5R652|RAD17_PONAB Cell cycle checkpoint protein RAD17 OS=Pongo abelii GN=RAD17 PE=2 SV=1 540 995 7.0E-35
sp|O75943|RAD17_HUMAN Cell cycle checkpoint protein RAD17 OS=Homo sapiens GN=RAD17 PE=1 SV=2 540 995 8.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50531|RAD17_SCHPO Checkpoint protein rad17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad17 PE=1 SV=1 535 987 1.0E-37
sp|Q6NXW6|RAD17_MOUSE Cell cycle checkpoint protein RAD17 OS=Mus musculus GN=Rad17 PE=1 SV=2 537 1002 2.0E-36
sp|Q9XT62|RAD17_CHLAE Cell cycle checkpoint protein RAD17 OS=Chlorocebus aethiops GN=RAD17 PE=1 SV=1 540 995 2.0E-35
sp|Q5R652|RAD17_PONAB Cell cycle checkpoint protein RAD17 OS=Pongo abelii GN=RAD17 PE=2 SV=1 540 995 7.0E-35
sp|O75943|RAD17_HUMAN Cell cycle checkpoint protein RAD17 OS=Homo sapiens GN=RAD17 PE=1 SV=2 540 995 8.0E-34
sp|P32641|RAD24_YEAST Checkpoint protein RAD24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD24 PE=1 SV=1 514 854 3.0E-20
sp|Q9MBA3|RAD17_ARATH Cell cycle checkpoint protein RAD17 OS=Arabidopsis thaliana GN=RAD17 PE=2 SV=1 541 910 1.0E-18
sp|Q9HIP7|RFCL_THEAC Replication factor C large subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rfcL PE=3 SV=1 538 800 7.0E-08
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcL PE=1 SV=3 540 647 1.0E-07
sp|Q12TX1|RFCL_METBU Replication factor C large subunit OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rfcL PE=3 SV=1 541 794 3.0E-07
sp|Q8Q084|RFCL_METMA Replication factor C large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcL PE=3 SV=1 541 640 6.0E-07
sp|Q5JHP1|RFCL_THEKO Replication factor C large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcL PE=1 SV=1 540 659 7.0E-07
sp|O57853|RFCL_PYRHO Replication factor C large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcL PE=3 SV=1 540 647 1.0E-06
sp|Q9UWR2|RFCL_PYRFU Replication factor C large subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcL PE=1 SV=1 540 659 2.0E-06
sp|Q46AT6|RFCL_METBF Replication factor C large subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcL PE=3 SV=1 541 640 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4757
MSGILSRLVGSQRTTQTTGLQPIEVHQVETDPDRRARCLKHLLKANHVNYAMVLDKTLAVNHSAHLLSAAYLLGA
SGDQLLALFESETQHLEPWVPAPAEVVDLDWEDFFGDKRYQRAYVDFFEDKLVMDFSYDWKKEVEHFLFVGEKPL
FHGLTGGLGHALVHLGYAYEMDCKEIAMEALSLACLQRNFLHKYLDDESYTRPSPLAPDSLLDLIESMSVDERFD
MLPTGVRSNEVEALFDEHQEFIMDYWNAWKIEDPVTQLREAQQTVVWLLMNSTATHTYNLSFVHLLATSHALRVL
LPVIPPHYHLALMREWWLLVIMIFIIKGLSWPSRLFVKEDIGSKDWAYVEKQALGSRWSKDAHYIKAKRRRRNPV
EDSDDEAEQPRATLANYLISSPTRKEPPSPSKNVTAQKRPRRAATQSNGVGPSPKKAASNGRSDEKPKTADLKTL
FSKQAQRTTRSATSARTNTPIDDIISDPISEEDEISDLKASSSSLVGQHARKRLKNSSSAGAVEVQSASRKFLKP
TKPATIPSVDDDLRPWSERFGPRNLDELAVHKRKVSDVRRWLEAVTAGRIRQRLLVLKGAAGSGKTTTVRLLAQD
MGLELLEWKNPAGSRDMLSPSTSAQFDEFLGRGGKFGMLDVEAPGTPSSSGVAAQDLSKRIMLVEEFPNTFSRTS
STLASFRKSILGFLDAAARPKSQAVNPMIVVISETLLTTTSATADSLTAHRLLGPEILRHPGAVVMEFNAIAPTF
LAKAMELIVQKEARKSGRRKTPGPMVLNRLGEIGDIRSAISALEFLCLKGDYEADWGAKVAFTKQKKGVRDGIGL
TQSEAETLESITQREASLGIFHAVGKVVYNKRDEAAPADDTVETLPSFMAEFARPNRSQVPVDSLIDEIGTDTQT
FVSALHENYILSCESTEPMDTSTSMDYVNECIEYLSLSDLLGPSRDVFFGGFGRDSSSSQQLRQDEMTFQVAVRG
LLFSLPHPVKRRPTGTLKGGDAFKMFYPTSIKLWKAKEEIEGLVDVWSSRLLRGEDQLGSKNSTDGANAFRKPTT
TSWTERAQRQATAANSEVSEARPPMWLGSTARREMVLDRLPYMAHLARARRSGTRDLEKMVAMRGTTTPTDEDED
GDAEVDGSAVEAWATDRPSEEASPRRRRAGVRAGEVSGLMAQKLVLSDDDIEDD*
Coding >Ophun1|4757
ATGTCCGGAATCCTGAGCCGGCTCGTGGGATCACAGCGTACAACGCAGACCACTGGCCTCCAGCCCATCGAGGTT
CACCAGGTAGAGACCGATCCTGACCGCCGAGCTCGATGCCTCAAGCACCTCCTCAAGGCCAATCATGTCAACTAT
GCCATGGTCCTGGACAAGACCCTCGCCGTCAATCACAGCGCTCATCTGCTCAGCGCCGCCTACCTCCTCGGTGCC
AGCGGTGACCAGCTTCTCGCTCTCTTCGAGTCAGAGACACAACACCTCGAGCCCTGGGTCCCCGCACCGGCCGAG
GTGGTCGACTTGGATTGGGAGGACTTCTTCGGCGACAAGCGCTACCAGAGGGCTTACGTTGATTTCTTCGAAGAC
AAGCTGGTCATGGACTTTTCTTACGACTGGAAGAAGGAGGTCGAGCACTTTCTCTTCGTCGGCGAGAAGCCCCTC
TTTCACGGCTTGACTGGTGGCCTCGGACATGCCCTCGTCCATCTGGGCTACGCTTATGAGATGGACTGTAAGGAG
ATTGCCATGGAAGCTCTCAGCCTGGCCTGCCTCCAAAGGAACTTTCTGCACAAGTATCTCGACGACGAGTCTTAT
ACGAGGCCGTCGCCGCTCGCGCCAGACTCTTTATTGGACCTGATCGAGAGCATGTCGGTTGACGAGAGATTCGAC
ATGCTGCCTACGGGCGTCCGCTCTAATGAAGTCGAGGCCCTGTTCGATGAGCACCAAGAGTTCATCATGGACTAC
TGGAACGCATGGAAGATTGAGGATCCAGTGACGCAGCTCCGAGAGGCACAACAGACAGTCGTCTGGTTGCTGATG
AATTCGACGGCTACTCATACGTACAACCTCAGCTTCGTCCATTTGCTGGCAACCAGTCATGCCTTGCGAGTACTG
CTGCCCGTCATTCCTCCCCATTATCACCTCGCCTTGATGCGGGAATGGTGGCTTCTGGTCATCATGATATTCATC
ATCAAGGGCCTGTCGTGGCCAAGTCGCCTGTTTGTCAAAGAGGATATCGGAAGCAAAGACTGGGCCTATGTCGAG
AAGCAGGCTCTCGGCTCTCGATGGTCCAAGGATGCCCACTATATCAAGGCGAAGCGCCGCAGGCGAAACCCGGTC
GAGGACTCTGACGACGAGGCCGAACAGCCTCGAGCCACGCTGGCCAACTACCTGATATCGTCCCCGACAAGAAAA
GAGCCGCCGAGTCCCTCAAAGAACGTCACCGCGCAGAAAAGACCTCGCAGAGCCGCGACGCAGAGCAATGGGGTC
GGGCCGAGCCCCAAAAAGGCGGCCAGCAACGGACGGTCCGACGAGAAGCCCAAGACGGCCGATCTCAAGACGCTC
TTCTCCAAGCAGGCTCAGAGAACGACGAGGTCGGCTACAAGCGCAAGGACGAACACGCCCATTGACGACATCATC
AGCGATCCCATCTCCGAGGAGGACGAAATCTCGGATCTCAAAGCCAGCTCCTCCAGCCTGGTCGGGCAGCATGCA
AGGAAACGCTTGAAGAACAGCTCCAGCGCCGGCGCGGTCGAAGTCCAGAGCGCAAGTCGGAAATTCCTGAAGCCG
ACGAAGCCGGCCACCATCCCCTCCGTCGACGACGATCTGCGGCCCTGGTCGGAAAGATTCGGCCCCAGAAACCTC
GACGAGCTGGCGGTGCACAAGAGAAAAGTTTCCGACGTCCGCAGGTGGCTCGAGGCCGTCACCGCTGGTCGGATA
CGGCAGCGGTTGCTGGTGCTCAAGGGCGCTGCGGGCTCTGGCAAGACGACAACGGTACGGCTGCTGGCGCAAGAC
ATGGGGCTGGAGCTATTGGAATGGAAGAATCCAGCAGGCTCCCGTGATATGCTTTCGCCGTCGACATCGGCACAG
TTTGACGAGTTCCTGGGCCGAGGGGGAAAGTTTGGTATGCTCGACGTCGAGGCGCCTGGCACACCCAGCAGTTCA
GGGGTTGCGGCTCAAGACCTATCCAAGAGGATCATGCTCGTCGAAGAGTTTCCAAACACTTTCTCTAGGACATCT
TCCACTCTGGCGTCGTTCCGGAAGTCTATTCTCGGCTTTCTCGACGCTGCTGCCCGACCCAAGTCGCAAGCAGTC
AATCCCATGATTGTCGTCATATCCGAGACTCTCCTGACGACAACCTCGGCAACGGCAGACAGCCTGACGGCCCAC
CGGCTTCTCGGGCCTGAGATTCTGCGTCACCCAGGCGCGGTGGTGATGGAATTCAACGCCATCGCGCCCACGTTC
CTGGCCAAGGCTATGGAGCTCATCGTGCAGAAAGAGGCGCGCAAGTCGGGGCGAAGGAAGACGCCGGGGCCGATG
GTGCTGAATCGGCTGGGCGAGATTGGCGACATTCGCAGCGCCATCTCGGCGCTCGAGTTTCTCTGCCTCAAAGGC
GACTACGAGGCCGACTGGGGAGCCAAGGTGGCGTTTACGAAGCAGAAAAAGGGCGTCCGAGATGGCATCGGCCTG
ACGCAGAGCGAAGCAGAGACTCTCGAGTCGATAACACAGCGCGAGGCCAGCCTGGGCATCTTTCACGCCGTCGGC
AAAGTCGTATACAACAAGCGAGACGAGGCGGCCCCAGCAGACGACACGGTGGAGACGCTGCCGTCGTTCATGGCC
GAGTTTGCGCGGCCCAACAGGTCGCAAGTGCCCGTCGACAGCCTCATCGACGAGATTGGGACGGACACGCAGACG
TTTGTATCGGCCCTGCACGAGAATTACATCTTGTCCTGTGAGAGCACGGAGCCGATGGACACGTCGACTTCGATG
GACTACGTCAACGAGTGCATCGAGTACCTCTCCCTCAGCGACCTGCTCGGACCGTCTAGGGACGTCTTCTTTGGC
GGGTTCGGGAGGGACAGCAGCAGCAGTCAGCAGCTGCGACAAGATGAGATGACGTTTCAGGTGGCCGTTCGAGGC
CTGTTGTTCTCGCTGCCGCACCCTGTCAAGCGGAGACCGACGGGGACGCTCAAAGGCGGTGACGCCTTCAAGATG
TTTTACCCGACGAGCATCAAGCTGTGGAAGGCAAAGGAGGAGATTGAAGGCCTCGTGGACGTGTGGTCATCACGA
CTACTCAGGGGCGAGGACCAGCTGGGAAGCAAGAACTCGACCGACGGCGCCAACGCATTCCGCAAACCGACGACG
ACATCGTGGACGGAGCGGGCGCAACGACAGGCTACAGCGGCGAACAGCGAGGTATCAGAGGCACGACCGCCCATG
TGGCTCGGCAGCACGGCACGACGGGAGATGGTGCTGGACCGGCTGCCGTACATGGCGCACCTGGCGCGCGCCAGG
AGAAGCGGCACGCGCGATCTGGAGAAGATGGTAGCTATGCGGGGAACGACGACACCAACAGACGAAGACGAAGAC
GGAGACGCAGAGGTAGACGGGTCTGCGGTCGAGGCGTGGGCCACAGACAGGCCATCAGAGGAAGCCAGTCCGCGG
AGACGACGTGCTGGGGTGAGGGCGGGAGAGGTCTCGGGGCTGATGGCGCAGAAGCTCGTGCTGAGTGACGATGAT
ATTGAGGATGATTAG
Transcript >Ophun1|4757
ATGTCCGGAATCCTGAGCCGGCTCGTGGGATCACAGCGTACAACGCAGACCACTGGCCTCCAGCCCATCGAGGTT
CACCAGGTAGAGACCGATCCTGACCGCCGAGCTCGATGCCTCAAGCACCTCCTCAAGGCCAATCATGTCAACTAT
GCCATGGTCCTGGACAAGACCCTCGCCGTCAATCACAGCGCTCATCTGCTCAGCGCCGCCTACCTCCTCGGTGCC
AGCGGTGACCAGCTTCTCGCTCTCTTCGAGTCAGAGACACAACACCTCGAGCCCTGGGTCCCCGCACCGGCCGAG
GTGGTCGACTTGGATTGGGAGGACTTCTTCGGCGACAAGCGCTACCAGAGGGCTTACGTTGATTTCTTCGAAGAC
AAGCTGGTCATGGACTTTTCTTACGACTGGAAGAAGGAGGTCGAGCACTTTCTCTTCGTCGGCGAGAAGCCCCTC
TTTCACGGCTTGACTGGTGGCCTCGGACATGCCCTCGTCCATCTGGGCTACGCTTATGAGATGGACTGTAAGGAG
ATTGCCATGGAAGCTCTCAGCCTGGCCTGCCTCCAAAGGAACTTTCTGCACAAGTATCTCGACGACGAGTCTTAT
ACGAGGCCGTCGCCGCTCGCGCCAGACTCTTTATTGGACCTGATCGAGAGCATGTCGGTTGACGAGAGATTCGAC
ATGCTGCCTACGGGCGTCCGCTCTAATGAAGTCGAGGCCCTGTTCGATGAGCACCAAGAGTTCATCATGGACTAC
TGGAACGCATGGAAGATTGAGGATCCAGTGACGCAGCTCCGAGAGGCACAACAGACAGTCGTCTGGTTGCTGATG
AATTCGACGGCTACTCATACGTACAACCTCAGCTTCGTCCATTTGCTGGCAACCAGTCATGCCTTGCGAGTACTG
CTGCCCGTCATTCCTCCCCATTATCACCTCGCCTTGATGCGGGAATGGTGGCTTCTGGTCATCATGATATTCATC
ATCAAGGGCCTGTCGTGGCCAAGTCGCCTGTTTGTCAAAGAGGATATCGGAAGCAAAGACTGGGCCTATGTCGAG
AAGCAGGCTCTCGGCTCTCGATGGTCCAAGGATGCCCACTATATCAAGGCGAAGCGCCGCAGGCGAAACCCGGTC
GAGGACTCTGACGACGAGGCCGAACAGCCTCGAGCCACGCTGGCCAACTACCTGATATCGTCCCCGACAAGAAAA
GAGCCGCCGAGTCCCTCAAAGAACGTCACCGCGCAGAAAAGACCTCGCAGAGCCGCGACGCAGAGCAATGGGGTC
GGGCCGAGCCCCAAAAAGGCGGCCAGCAACGGACGGTCCGACGAGAAGCCCAAGACGGCCGATCTCAAGACGCTC
TTCTCCAAGCAGGCTCAGAGAACGACGAGGTCGGCTACAAGCGCAAGGACGAACACGCCCATTGACGACATCATC
AGCGATCCCATCTCCGAGGAGGACGAAATCTCGGATCTCAAAGCCAGCTCCTCCAGCCTGGTCGGGCAGCATGCA
AGGAAACGCTTGAAGAACAGCTCCAGCGCCGGCGCGGTCGAAGTCCAGAGCGCAAGTCGGAAATTCCTGAAGCCG
ACGAAGCCGGCCACCATCCCCTCCGTCGACGACGATCTGCGGCCCTGGTCGGAAAGATTCGGCCCCAGAAACCTC
GACGAGCTGGCGGTGCACAAGAGAAAAGTTTCCGACGTCCGCAGGTGGCTCGAGGCCGTCACCGCTGGTCGGATA
CGGCAGCGGTTGCTGGTGCTCAAGGGCGCTGCGGGCTCTGGCAAGACGACAACGGTACGGCTGCTGGCGCAAGAC
ATGGGGCTGGAGCTATTGGAATGGAAGAATCCAGCAGGCTCCCGTGATATGCTTTCGCCGTCGACATCGGCACAG
TTTGACGAGTTCCTGGGCCGAGGGGGAAAGTTTGGTATGCTCGACGTCGAGGCGCCTGGCACACCCAGCAGTTCA
GGGGTTGCGGCTCAAGACCTATCCAAGAGGATCATGCTCGTCGAAGAGTTTCCAAACACTTTCTCTAGGACATCT
TCCACTCTGGCGTCGTTCCGGAAGTCTATTCTCGGCTTTCTCGACGCTGCTGCCCGACCCAAGTCGCAAGCAGTC
AATCCCATGATTGTCGTCATATCCGAGACTCTCCTGACGACAACCTCGGCAACGGCAGACAGCCTGACGGCCCAC
CGGCTTCTCGGGCCTGAGATTCTGCGTCACCCAGGCGCGGTGGTGATGGAATTCAACGCCATCGCGCCCACGTTC
CTGGCCAAGGCTATGGAGCTCATCGTGCAGAAAGAGGCGCGCAAGTCGGGGCGAAGGAAGACGCCGGGGCCGATG
GTGCTGAATCGGCTGGGCGAGATTGGCGACATTCGCAGCGCCATCTCGGCGCTCGAGTTTCTCTGCCTCAAAGGC
GACTACGAGGCCGACTGGGGAGCCAAGGTGGCGTTTACGAAGCAGAAAAAGGGCGTCCGAGATGGCATCGGCCTG
ACGCAGAGCGAAGCAGAGACTCTCGAGTCGATAACACAGCGCGAGGCCAGCCTGGGCATCTTTCACGCCGTCGGC
AAAGTCGTATACAACAAGCGAGACGAGGCGGCCCCAGCAGACGACACGGTGGAGACGCTGCCGTCGTTCATGGCC
GAGTTTGCGCGGCCCAACAGGTCGCAAGTGCCCGTCGACAGCCTCATCGACGAGATTGGGACGGACACGCAGACG
TTTGTATCGGCCCTGCACGAGAATTACATCTTGTCCTGTGAGAGCACGGAGCCGATGGACACGTCGACTTCGATG
GACTACGTCAACGAGTGCATCGAGTACCTCTCCCTCAGCGACCTGCTCGGACCGTCTAGGGACGTCTTCTTTGGC
GGGTTCGGGAGGGACAGCAGCAGCAGTCAGCAGCTGCGACAAGATGAGATGACGTTTCAGGTGGCCGTTCGAGGC
CTGTTGTTCTCGCTGCCGCACCCTGTCAAGCGGAGACCGACGGGGACGCTCAAAGGCGGTGACGCCTTCAAGATG
TTTTACCCGACGAGCATCAAGCTGTGGAAGGCAAAGGAGGAGATTGAAGGCCTCGTGGACGTGTGGTCATCACGA
CTACTCAGGGGCGAGGACCAGCTGGGAAGCAAGAACTCGACCGACGGCGCCAACGCATTCCGCAAACCGACGACG
ACATCGTGGACGGAGCGGGCGCAACGACAGGCTACAGCGGCGAACAGCGAGGTATCAGAGGCACGACCGCCCATG
TGGCTCGGCAGCACGGCACGACGGGAGATGGTGCTGGACCGGCTGCCGTACATGGCGCACCTGGCGCGCGCCAGG
AGAAGCGGCACGCGCGATCTGGAGAAGATGGTAGCTATGCGGGGAACGACGACACCAACAGACGAAGACGAAGAC
GGAGACGCAGAGGTAGACGGGTCTGCGGTCGAGGCGTGGGCCACAGACAGGCCATCAGAGGAAGCCAGTCCGCGG
AGACGACGTGCTGGGGTGAGGGCGGGAGAGGTCTCGGGGCTGATGGCGCAGAAGCTCGTGCTGAGTGACGATGAT
ATTGAGGATGATTAG
Gene >Ophun1|4757
ATGTCCGGAATCCTGAGCCGGCTCGTGGGATCACAGCGTACAACGCAGACCACTGGCCTCCAGCCCATCGAGGTT
CACCAGGTAGAGACCGATCCTGACCGCCGAGCTCGATGCCTCAAGCACCTCCTCAAGGCCAATCATGTCAACTAT
GCCATGGTCCTGGACAAGACCCTCGCCGTCAATCACAGCGCTCATCTGCTCAGCGCCGCCTACCTCCTCGGTGCC
AGCGGTGACCAGCTTCTCGCTCTCTTCGAGTCAGAGACACAACACCTCGAGCCCTGGGTCCCCGCACCGGCCGAG
GTGGTCGACTTGGATTGGGAGGACTTCTTCGGCGACAAGCGCTACCAGAGGGCTTACGTTGATTTCTTCGAAGAC
AAGCTGGTCATGGACTTTTCTTACGACTGGAAGAAGGAGGTCGAGCACTTTCTCTTCGTCGGCGAGAAGCCCCTC
TTTCACGGCTTGACTGGTGGCCGTATGTCTGACCCCGTAGAGCTGGTTATCGAGCTGACGCGTCGCTAGTCGGAC
ATGCCCTCGTCCATCTGGGCTACGCTTATGAGATGGACTGTAAGGAGATTGCCATGGAAGCTCTCAGCCTGGCCT
GCCTCCAAAGGAACTTTCTGCACAAGTATCTCGACGACGAGTCTTATACGAGGCCGTCGCCGCTCGCGCCAGACT
CTTTATTGGACCTGATCGAGAGCATGTCGGTTGACGAGAGATTCGACATGCTGCCTACGGGCGTCCGCTCTAATG
AAGTCGAGGCCCTGTTCGATGAGCACCAAGAGTTCATCATGGACTACTGGAACGCATGGAAGATTGAGGATCCAG
TGACGCAGCTCCGAGAGGCACAACAGACAGTCGTCTGGTTGCTGATGAATTCGACGGCTACTCATACGTACAACC
TCAGCTTCGTCCATTTGCTGGCAACCAGTCATGCCTTGCGAGTACTGCTGCCCGTCATTCCTCCCCATTATCACC
TCGCCTTGATGCGGGAATGGTGGCTTCTGGTCATCATGATATTCATCATCAAGGGCCTGTCGTGGCCAAGTCGCC
TGTTTGTCAAAGAGGATATCGGAAGCAAAGACTGGGCCTATGTCGAGAAGCAGGCTCTCGGCTCTCGATGGTCCA
AGGATGCCCACTATATCAAGGGTGAGAGTCCCGCGACCCCGGCAGGTAACGTGCTGACGGACGCAGCGATTCGCG
CGATGAGGGATGCTGCAAAGACGTGGGGGGATGCAGATGATCAATTTCTTCAGAGCGCAGTAGCATTTGTCGATG
GCTTCAAAGGCTGGACGTATTGAAATGGACGTTGAGTCGATTCTTATCTGTAGAACGGCTCCTGCTAAGGTGGCT
CACTGTGTCATCTAAGAACCGCCATGCACCGTGTACAGTCAGCTGCGAGCGCCTTGTGGGTTGCTCCGGCGGACG
ACTATTCCTGGCCCTGCTGCCACGAGGCTACCAACGACTACAGCCTACGAGTGCCTACAGGACAATTTTCAGTCT
ACGGAGAGGCTACTTGTTGACTACAGACCGATGTCTGCGTGAAAGACCCTTCGCCACTCCAATGGCCCCGCCAGC
GAAGCGCCGCAGGCGAAACCCGGTCGAGGACTCTGACGACGAGGCCGAACAGCCTCGAGCCACGCTGGCCAACTA
CCTGATATCGTCCCCGACAAGAAAAGAGCCGCCGAGTCCCTCAAAGAACGTCACCGCGCAGAAAAGACCTCGCAG
AGCCGCGACGCAGAGCAATGGGGTCGGGCCGAGCCCCAAAAAGGCGGCCAGCAACGGACGGTCCGACGAGAAGCC
CAAGACGGCCGATCTCAAGACGCTCTTCTCCAAGCAGGCTCAGAGAACGACGAGGTCGGCTACAAGCGCAAGGAC
GAACACGCCCATTGACGACATCATCAGCGATCCCATCTCCGAGGAGGACGAAATCTCGGATCTCAAAGCCAGCTC
CTCCAGCCTGGTCGGGCAGCATGCAAGGAAACGCTTGAAGAACAGCTCCAGCGCCGGCGCGGTCGAAGTCCAGAG
CGCAAGTCGGAAATTCCTGAAGCCGACGAAGCCGGCCACCATCCCCTCCGTCGACGACGATCTGCGGCCCTGGTC
GGAAAGATTCGGCCCCAGAAACCTCGACGAGCTGGCGGTGCACAAGAGAAAAGTTTCCGACGTCCGCAGGTGGCT
CGAGGCCGTCACCGCTGGTCGGATACGGCAGCGGTTGCTGGTGCTCAAGGGCGCTGCGGGCTCTGGCAAGACGAC
AACGGTACGGCTGCTGGCGCAAGACATGGGGCTGGAGCTATTGGAATGGAAGAATCCAGCAGGCTCCCGTGATAT
GCTTTCGCCGTCGACATCGGCACAGTTTGACGAGTTCCTGGGCCGAGGGGGAAAGTTTGGTATGCTCGACGTCGA
GGCGCCTGGCACACCCAGCAGTTCAGGGGTTGCGGCTCAAGACCTATCCAAGAGGATCATGCTCGTCGAAGAGTT
TCCAAACACTTTCTCTAGGACATCTTCCACTCTGGCGTCGTTCCGGAAGTCTATTCTCGGCTTTCTCGACGCTGC
TGCCCGACCCAAGTCGCAAGCAGTCAATCCCATGATTGTCGTCATATCCGAGACTCTCCTGACGACAACCTCGGC
AACGGCAGACAGCCTGACGGCCCACCGGCTTCTCGGGCCTGAGATTCTGCGTCACCCAGGCGCGGTGGTGATGGA
ATTCAACGCCATCGCGCCCACGTTCCTGGCCAAGGCTATGGAGCTCATCGTGCAGAAAGAGGCGCGCAAGTCGGG
GCGAAGGAAGACGCCGGGGCCGATGGTGCTGAATCGGCTGGGCGAGATTGGCGACATTCGCAGCGCCATCTCGGC
GCTCGAGTTTCTCTGCCTCAAAGGCGACTACGAGGCCGACTGGGGAGCCAAGGTGGCGTTTACGAAGCAGAAAAA
GGGCGTCCGAGATGGCATCGGCCTGACGCAGAGCGAAGCAGAGACTCTCGAGTCGATAACACAGCGCGAGGCCAG
CCTGGGCATCTTTCACGCCGTCGGCAAAGTCGTATACAACAAGCGAGACGAGGCGGCCCCAGCAGACGACACGGT
GGAGACGCTGCCGTCGTTCATGGCCGAGTTTGCGCGGCCCAACAGGTCGCAAGTGCCCGTCGACAGCCTCATCGA
CGAGATTGGGACGGACACGCAGACGTTTGTATCGGCCCTGCACGAGAATTACATCTTGTCCTGTGAGAGCACGGA
GCCGATGGACACGTCGACTTCGATGGACTACGTCAACGAGTGCATCGAGTACCTCTCCCTCAGCGACCTGCTCGG
ACCGTCTAGGGACGTCTTCTTTGGCGGGTTCGGGAGGGACAGCAGCAGCAGTCAGCAGCTGCGACAAGATGAGAT
GACGTTTCAGGTGGCCGTTCGAGGCCTGTTGTTCTCGCTGCCGCACCCTGTCAAGCGGAGACCGACGGGGACGCT
CAAAGGCGGTGACGCCTTCAAGATGTTTTACCCGACGAGCATCAAGCTGTGGAAGGCAAAGGAGGAGATTGAAGG
CCTCGTGGACGTGTGGTCATCACGACTACTCAGGGGCGAGGACCAGCTGGGAAGCAAGAACTCGACCGACGGCGC
CAACGCATTCCGCAAACCGACGACGACATCGTGGACGGAGCGGGCGCAACGACAGGCTACAGCGGCGAACAGCGA
GGTATCAGAGGCACGACCGCCCATGTGGCTCGGCAGCACGGCACGACGGGAGATGGTGCTGGACCGGCTGCCGTA
CATGGCGCACCTGGCGCGCGCCAGGAGAAGCGGCACGCGCGATCTGGAGAAGATGGTAGCTATGCGGGGAACGAC
GACACCAACAGACGAAGACGAAGACGGAGACGCAGAGGTAGACGGGTCTGCGGTCGAGGCGTGGGCCACAGACAG
GCCATCAGAGGAAGCCAGTCCGCGGAGACGACGTGCTGGGGTGAGGGCGGGAGAGGTCTCGGGGCTGATGGCGCA
GAAGCTCGTGCTGAGTGACGATGATATTGAGGATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail