Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4746
Gene name
LocationContig_444:11937..13686
Strand-
Gene length (bp)1749
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 3.3E-27 118 524

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 99 544 1.0E-57

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 126 148 22
2 153 175 22
3 196 218 22
4 233 252 19
5 264 286 22
6 314 336 22
7 348 370 22
8 394 416 22
9 428 450 22
10 460 482 22
11 502 524 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4746
MNRQPPPAPEKPFGPASARELDRAISSSSSPDARPSPPPLSPPRRGRRRAMLGLGGAGVTIGPRITALPAWLKDE
SVAAETAAGVGASSDDDTEAASSNAIVNRQLASETGRSIQYRTCSWQKTAALLFSEYICLAIMSFPWSYSYLGLV
PGLILTIVIAAVVLYTSLVLWELCLRHPEVRDVCDLGQMLFWEKPWAWWATAIMFVLNNTFIQGLHVLVGAEYLN
TMTETHAISGCRTVQFSLIVTFICWVASLPRTFSMLSKLGTAAAFFTFVAVILATVFAAVQPRPAGFDPVKGMPL
WTALPVKSTTFVQGMAAFLNISYTFIGQITLPSFIAEMRDPREFPKSLWACTIAEIITFSIVGAVIYVYTGNQYV
KSPAFGSLEDLYKKVSFSFMIPTIIFLGCLYASVTARFVFFRVFRGSRHLNDHTLVGWGSWGGILLCTWILAFLI
SQLIPFFSSLLAVMSSLFDSWFGFIFWGVAYFRMRDADLAAGFRRRPLTDMLSMALNVVIILTGFFFLTVGTYAS
VQGIIDSFRSGEVGGVFSCKSNGV*
Coding >Ophun1|4746
ATGAATCGACAGCCTCCTCCCGCCCCGGAAAAGCCCTTCGGCCCGGCATCCGCCCGGGAACTCGACCGCGCCATA
TCTTCATCCTCCTCTCCCGATGCCCGACCATCTCCGCCCCCGCTCTCGCCTCCCCGTCGGGGCCGGCGCCGCGCC
ATGCTCGGCCTCGGAGGCGCGGGCGTCACCATCGGGCCTCGCATCACCGCTTTGCCAGCGTGGCTCAAGGACGAG
AGCGTGGCGGCGGAGACGGCTGCTGGCGTGGGCGCTTCTTCGGATGATGATACGGAAGCGGCGTCAAGCAACGCC
ATCGTCAACCGGCAGCTTGCTTCCGAGACGGGCCGGTCGATTCAGTACCGGACTTGCAGCTGGCAGAAGACGGCG
GCACTGCTGTTTAGCGAGTACATCTGCCTGGCCATCATGAGCTTCCCCTGGTCCTACAGCTATCTCGGTCTGGTT
CCCGGTCTGATCCTCACCATTGTCATTGCTGCTGTCGTGCTATACACCAGCCTCGTCCTCTGGGAACTCTGCCTG
CGCCATCCCGAGGTGCGAGACGTGTGCGATCTCGGACAGATGCTCTTCTGGGAGAAGCCATGGGCCTGGTGGGCG
ACGGCCATCATGTTTGTCCTCAACAACACCTTTATCCAGGGCCTACACGTCCTCGTCGGAGCCGAGTATCTCAAC
ACCATGACCGAGACGCATGCCATTTCCGGCTGTCGAACCGTTCAGTTCTCTCTGATTGTTACTTTCATCTGCTGG
GTGGCTTCGCTTCCGCGCACCTTTAGCATGCTTTCCAAGCTCGGGACGGCCGCCGCCTTCTTCACCTTTGTCGCC
GTCATTCTCGCCACCGTCTTTGCTGCCGTTCAGCCTCGACCTGCTGGCTTCGATCCCGTCAAGGGAATGCCCTTG
TGGACGGCACTGCCGGTCAAGAGCACCACCTTTGTCCAGGGCATGGCCGCCTTTCTCAACATAAGCTACACCTTT
ATCGGCCAGATCACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCGCGCGAGTTCCCCAAGTCGCTCTGGGCC
TGCACCATTGCCGAGATCATCACCTTTAGCATCGTCGGCGCCGTCATCTACGTCTACACGGGCAATCAGTACGTC
AAGTCGCCGGCCTTTGGCTCGCTCGAGGATCTATACAAAAAGGTGTCGTTTTCATTCATGATTCCCACCATCATC
TTCCTCGGCTGTCTGTACGCGTCGGTGACGGCCCGCTTCGTCTTCTTCCGCGTCTTCCGCGGCTCGCGTCATCTC
AACGACCATACCTTGGTGGGCTGGGGAAGTTGGGGCGGCATCTTGCTGTGCACGTGGATTCTTGCCTTTTTGATA
TCCCAGCTGATTCCCTTTTTCTCTTCCCTACTGGCCGTCATGTCGTCTCTATTCGACAGCTGGTTCGGCTTCATC
TTCTGGGGCGTCGCCTACTTTCGCATGCGAGACGCCGACCTCGCCGCCGGGTTCCGACGCCGGCCCCTGACCGAC
ATGCTATCCATGGCCCTCAACGTCGTCATCATCCTCACCGGCTTCTTCTTCCTCACCGTCGGAACCTACGCCAGC
GTCCAGGGAATCATCGACTCGTTCCGCTCCGGCGAGGTCGGCGGCGTCTTCTCCTGCAAGAGCAACGGCGTCTGA
Transcript >Ophun1|4746
ATGAATCGACAGCCTCCTCCCGCCCCGGAAAAGCCCTTCGGCCCGGCATCCGCCCGGGAACTCGACCGCGCCATA
TCTTCATCCTCCTCTCCCGATGCCCGACCATCTCCGCCCCCGCTCTCGCCTCCCCGTCGGGGCCGGCGCCGCGCC
ATGCTCGGCCTCGGAGGCGCGGGCGTCACCATCGGGCCTCGCATCACCGCTTTGCCAGCGTGGCTCAAGGACGAG
AGCGTGGCGGCGGAGACGGCTGCTGGCGTGGGCGCTTCTTCGGATGATGATACGGAAGCGGCGTCAAGCAACGCC
ATCGTCAACCGGCAGCTTGCTTCCGAGACGGGCCGGTCGATTCAGTACCGGACTTGCAGCTGGCAGAAGACGGCG
GCACTGCTGTTTAGCGAGTACATCTGCCTGGCCATCATGAGCTTCCCCTGGTCCTACAGCTATCTCGGTCTGGTT
CCCGGTCTGATCCTCACCATTGTCATTGCTGCTGTCGTGCTATACACCAGCCTCGTCCTCTGGGAACTCTGCCTG
CGCCATCCCGAGGTGCGAGACGTGTGCGATCTCGGACAGATGCTCTTCTGGGAGAAGCCATGGGCCTGGTGGGCG
ACGGCCATCATGTTTGTCCTCAACAACACCTTTATCCAGGGCCTACACGTCCTCGTCGGAGCCGAGTATCTCAAC
ACCATGACCGAGACGCATGCCATTTCCGGCTGTCGAACCGTTCAGTTCTCTCTGATTGTTACTTTCATCTGCTGG
GTGGCTTCGCTTCCGCGCACCTTTAGCATGCTTTCCAAGCTCGGGACGGCCGCCGCCTTCTTCACCTTTGTCGCC
GTCATTCTCGCCACCGTCTTTGCTGCCGTTCAGCCTCGACCTGCTGGCTTCGATCCCGTCAAGGGAATGCCCTTG
TGGACGGCACTGCCGGTCAAGAGCACCACCTTTGTCCAGGGCATGGCCGCCTTTCTCAACATAAGCTACACCTTT
ATCGGCCAGATCACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCGCGCGAGTTCCCCAAGTCGCTCTGGGCC
TGCACCATTGCCGAGATCATCACCTTTAGCATCGTCGGCGCCGTCATCTACGTCTACACGGGCAATCAGTACGTC
AAGTCGCCGGCCTTTGGCTCGCTCGAGGATCTATACAAAAAGGTGTCGTTTTCATTCATGATTCCCACCATCATC
TTCCTCGGCTGTCTGTACGCGTCGGTGACGGCCCGCTTCGTCTTCTTCCGCGTCTTCCGCGGCTCGCGTCATCTC
AACGACCATACCTTGGTGGGCTGGGGAAGTTGGGGCGGCATCTTGCTGTGCACGTGGATTCTTGCCTTTTTGATA
TCCCAGCTGATTCCCTTTTTCTCTTCCCTACTGGCCGTCATGTCGTCTCTATTCGACAGCTGGTTCGGCTTCATC
TTCTGGGGCGTCGCCTACTTTCGCATGCGAGACGCCGACCTCGCCGCCGGGTTCCGACGCCGGCCCCTGACCGAC
ATGCTATCCATGGCCCTCAACGTCGTCATCATCCTCACCGGCTTCTTCTTCCTCACCGTCGGAACCTACGCCAGC
GTCCAGGGAATCATCGACTCGTTCCGCTCCGGCGAGGTCGGCGGCGTCTTCTCCTGCAAGAGCAACGGCGTCTGA
Gene >Ophun1|4746
ATGAATCGACAGCCTCCTCCCGCCCCGGAAAAGCCCTTCGGCCCGGCATCCGCCCGGGAACTCGACCGCGCCATA
TCTTCATCCTCCTCTCCCGATGCCCGACCATCTCCGCCCCCGCTCTCGCCTCCCCGTCGGGGCCGGCGCCGCGCC
ATGCTCGGCCTCGGAGGCGCGGGCGTCACCATCGGGCCTCGCATCACCGCTTTGCCAGCGTGGCTCAAGGACGAG
AGCGTGGCGGCGGAGACGGCTGCTGGCGTGGGCGCTTCTTCGGATGATGATACGGAAGCGGCGTCAAGCAACGCC
ATCGTCAACCGGCAGCTTGCTTCCGAGACGGGCCGGTCGATTCAGTACCGGACTTGCAGCTGGCAGAAGACGGCG
GCACTGCTGTTTAGCGAGTACATCTGCCTGGCCATCATGAGCTTCCCCTGGTCCTACAGCTATCTCGGTCTGGTT
CCCGGTCTGATCCTCACCATTGTCATTGCTGCTGTCGTGCTATACACCAGCCTCGTCCTCTGGGAACTCTGCCTG
CGCCATCCCGAGGTGCGAGACGTGTGCGATCTCGGACAGATGCTCTTCTGGGAGAAGCCATGGGCCTGGTGGGCG
ACGGCCATCATGTTTGTCCTCAACAACACCTTTATCCAGGGCCTACACGTCCTCGTCGGAGCCGAGTATCTCAAC
ACCATGACCGAGACGCATGCCATTTCCGGCTGTCGAACCGTTCAGTTCTCTCTGATTGTTACTTTCATCTGCTGG
GTGGCTTCGCTTCCGCGCACCTTTAGCATGCTTTCCAAGCTCGGGACGGCCGCCGCCTTCTTCACCTTTGTCGCC
GTCATTCTCGCCACCGTCTTTGCTGCCGTTCAGCCTCGACCTGCTGGCTTCGATCCCGTCAAGGGAATGCCCTTG
TGGACGGCACTGCCGGTCAAGAGCACCACCTTTGTCCAGGGCATGGCCGCCTTTCTCAACATAAGCTACACCTTT
ATCGGCCAGATCACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCGCGGTAAGCAAACGCCGTCTTGTCTTTT
CACTGTCCATCTGCTAACTTCGTCCAGCGAGTTCCCCAAGTCGCTCTGGGCCTGCACCATTGCCGAGATCATCAC
CTTTAGCATCGTCGGCGCCGTCATCTACGTCTACACGGGCAATCAGTACGTCAAGTCGCCGGCCTTTGGCTCGCT
CGAGGATCTATACAAAAAGGTGTCGTTTTCATTCATGATTCCCACCATCATCTTCCTCGGCTGTCTGTACGCGTC
GGTGACGGCCCGCTTCGTCTTCTTCCGCGTCTTCCGCGGCTCGCGTCATCTCAACGACCATACCTTGGTGGGCTG
GGGAAGTTGGGGCGGCATCTTGCTGTGCACGTGGATTCTTGCCTTTTTGATATCCCAGCTGATTCCCTTTTTCTC
TTCCCGTGAGTATCTCTCATCTCTTGATAATCCCACGGCTAAGACAGCATAGTACTGGCCGTCATGTCGTCTCTA
TTCGACAGCTGGTTCGGCTTCATCTTCTGGGGCGTCGCCTACTTTCGCATGCGAGACGCCGACCTCGCCGCCGGG
TTCCGACGCCGGCCCCTGACCGACATGCTATCCATGGCCCTCAACGTCGTCATCATCCTCACCGGCTTCTTCTTC
CTCACCGTCGGAACCTACGCCAGCGTCCAGGGAATCATCGACTCGTTCCGCTCCGGCGAGGTCGGCGGCGTCTTC
TCCTGCAAGAGCAACGGCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail