Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4745
Gene name
LocationContig_444:10217..11328
Strand-
Gene length (bp)1111
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 1.8E-24 80 309
PF08557 Lipid_DES Sphingolipid Delta4-desaturase (DES) 2.3E-18 16 50

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C4R613|DEGS_PICPG Sphingolipid delta(4)-desaturase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr3_0939 PE=1 SV=2 5 341 1.0E-130
sp|O59715|DEGS_SCHPO Sphingolipid delta(4)-desaturase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsd1 PE=1 SV=1 4 339 9.0E-128
sp|Q5AJX2|DEGS_CANAL Sphingolipid delta(4)-desaturase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DES1 PE=1 SV=1 6 342 3.0E-120
sp|Q6H5U3|DES1L_ORYSJ Sphingolipid delta(4)-desaturase DES1-like OS=Oryza sativa subsp. japonica GN=Os02g0639600 PE=2 SV=1 17 342 4.0E-100
sp|Q9ZPH4|DES1L_ARATH Sphingolipid delta(4)-desaturase DES1-like OS=Arabidopsis thaliana GN=At4g04930 PE=2 SV=1 17 341 4.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C4R613|DEGS_PICPG Sphingolipid delta(4)-desaturase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr3_0939 PE=1 SV=2 5 341 1.0E-130
sp|O59715|DEGS_SCHPO Sphingolipid delta(4)-desaturase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsd1 PE=1 SV=1 4 339 9.0E-128
sp|Q5AJX2|DEGS_CANAL Sphingolipid delta(4)-desaturase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DES1 PE=1 SV=1 6 342 3.0E-120
sp|Q6H5U3|DES1L_ORYSJ Sphingolipid delta(4)-desaturase DES1-like OS=Oryza sativa subsp. japonica GN=Os02g0639600 PE=2 SV=1 17 342 4.0E-100
sp|Q9ZPH4|DES1L_ARATH Sphingolipid delta(4)-desaturase DES1-like OS=Arabidopsis thaliana GN=At4g04930 PE=2 SV=1 17 341 4.0E-98
sp|Q6QHC5|DEGS2_HUMAN Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Homo sapiens GN=DEGS2 PE=1 SV=2 17 343 6.0E-89
sp|Q5F3C1|DEGS1_CHICK Sphingolipid delta(4)-desaturase DES1 OS=Gallus gallus GN=DEGS1 PE=2 SV=1 17 338 7.0E-89
sp|Q68FB8|DEGS1_XENTR Sphingolipid delta(4)-desaturase DES1 OS=Xenopus tropicalis GN=degs1 PE=2 SV=1 17 338 2.0E-87
sp|G5EC63|DEGS2_CAEEL Putative sphingolipid delta(4)-desaturase/C4-monooxygenase OS=Caenorhabditis elegans GN=ttm-5 PE=3 SV=1 17 338 1.0E-86
sp|Q3ZBY7|DEGS1_BOVIN Sphingolipid delta(4)-desaturase DES1 OS=Bos taurus GN=DEGS1 PE=2 SV=1 17 337 1.0E-85
sp|O44186|DEGS1_CAEEL Putative sphingolipid delta(4)-desaturase OS=Caenorhabditis elegans GN=F33D4.4 PE=3 SV=1 10 346 2.0E-84
sp|Q8R2F2|DEGS2_MOUSE Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Mus musculus GN=Degs2 PE=1 SV=1 17 338 4.0E-84
sp|Q564G3|DEGS2_RAT Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Rattus norvegicus GN=Degs2 PE=1 SV=1 17 338 4.0E-84
sp|Q0II71|DEGS2_BOVIN Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Bos taurus GN=DEGS2 PE=2 SV=1 17 337 1.0E-83
sp|Q5RE51|DEGS1_PONAB Sphingolipid delta(4)-desaturase DES1 OS=Pongo abelii GN=DEGS1 PE=2 SV=1 17 342 4.0E-82
sp|O15121|DEGS1_HUMAN Sphingolipid delta(4)-desaturase DES1 OS=Homo sapiens GN=DEGS1 PE=1 SV=1 17 342 4.0E-82
sp|Q5XIF5|DEGS1_RAT Sphingolipid delta(4)-desaturase DES1 OS=Rattus norvegicus GN=Degs1 PE=2 SV=1 17 337 2.0E-81
sp|Q6UQ04|DEGS1_MICFO Sphingolipid delta(4)-desaturase DES1 OS=Microtus fortis GN=DEGS1 PE=2 SV=1 17 337 3.0E-81
sp|O09005|DEGS1_MOUSE Sphingolipid delta(4)-desaturase DES1 OS=Mus musculus GN=Degs1 PE=1 SV=1 17 337 1.0E-80
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 53 70 17
2 75 97 22
3 110 132 22
4 158 180 22
5 193 212 19
6 216 238 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4745
MTNPPPKAPSATPPDHDFIWTYTEEPHRTRRLAIIKAHPEVTKLCGPEPLTKYVVALVVAIQVTTAWLLSSSDFW
TLRFWLVAYVIGATANQNLFLAIHEISHNLAFRSPLANRVFAVFANLPIGVPYSASFRPYHLTHHKSLGVDGIDT
DLPTALEAVILDSLLGKAFFCTFQIFFYAIRPMTVYRVPFTKLHVFNVMVQLLFDLAIVRFLSPTALAYLILSSF
LAGSLHPLAAHFIAEHYVYDLPQHLTRQLSSSSATPVPETFSYYGPLNWLTYNVGLHNEHHDFPAIPWSRLPTLR
RIADEFYRDLPCHTSWSYALWRFIWDDGVGMTCRVKRERAKKGRWAESEVQA*
Coding >Ophun1|4745
ATGACCAATCCCCCCCCAAAAGCCCCCTCAGCCACCCCCCCAGACCACGACTTCATCTGGACCTACACCGAAGAA
CCCCACCGAACCCGCCGCCTCGCCATCATAAAAGCCCACCCCGAAGTAACCAAGCTATGCGGCCCCGAACCTCTG
ACCAAGTACGTCGTCGCCCTGGTCGTGGCCATCCAGGTGACGACGGCATGGCTCCTCTCCAGCAGCGACTTCTGG
ACGCTGCGCTTCTGGCTGGTCGCCTACGTCATCGGCGCGACGGCCAACCAGAATCTCTTCCTGGCCATACACGAG
ATTTCGCATAACTTGGCGTTTCGCTCTCCGCTGGCGAATAGGGTCTTTGCTGTTTTCGCCAATCTACCCATCGGC
GTCCCCTACAGCGCTTCCTTTCGACCTTATCATCTTACCCATCACAAGTCCCTGGGCGTAGATGGCATCGACACC
GATCTCCCCACCGCACTCGAAGCCGTCATCCTCGACTCCCTCCTCGGAAAAGCCTTCTTCTGCACCTTTCAAATC
TTCTTCTACGCCATTCGCCCCATGACCGTCTACCGCGTCCCCTTTACAAAACTGCACGTCTTCAACGTCATGGTC
CAACTCCTCTTCGACCTCGCCATCGTCCGCTTCCTCTCCCCCACGGCACTGGCATACCTCATCCTCTCCTCCTTT
CTCGCCGGGAGCCTCCACCCCCTGGCAGCGCACTTCATAGCAGAGCACTACGTCTACGACCTCCCCCAGCATCTA
ACCCGACAGCTCTCCTCCTCCAGCGCGACCCCCGTCCCAGAAACATTCTCCTACTACGGCCCGCTGAACTGGCTC
ACCTACAACGTAGGCCTCCACAACGAACACCACGACTTCCCCGCCATCCCCTGGTCCCGCCTCCCGACGCTGCGC
AGAATCGCGGACGAGTTCTACCGCGACCTGCCCTGCCATACCAGCTGGTCGTATGCGCTTTGGCGCTTCATCTGG
GATGATGGCGTGGGCATGACTTGTCGGGTCAAGAGGGAGAGGGCTAAGAAGGGGAGGTGGGCCGAGTCTGAGGTT
CAGGCTTGA
Transcript >Ophun1|4745
ATGACCAATCCCCCCCCAAAAGCCCCCTCAGCCACCCCCCCAGACCACGACTTCATCTGGACCTACACCGAAGAA
CCCCACCGAACCCGCCGCCTCGCCATCATAAAAGCCCACCCCGAAGTAACCAAGCTATGCGGCCCCGAACCTCTG
ACCAAGTACGTCGTCGCCCTGGTCGTGGCCATCCAGGTGACGACGGCATGGCTCCTCTCCAGCAGCGACTTCTGG
ACGCTGCGCTTCTGGCTGGTCGCCTACGTCATCGGCGCGACGGCCAACCAGAATCTCTTCCTGGCCATACACGAG
ATTTCGCATAACTTGGCGTTTCGCTCTCCGCTGGCGAATAGGGTCTTTGCTGTTTTCGCCAATCTACCCATCGGC
GTCCCCTACAGCGCTTCCTTTCGACCTTATCATCTTACCCATCACAAGTCCCTGGGCGTAGATGGCATCGACACC
GATCTCCCCACCGCACTCGAAGCCGTCATCCTCGACTCCCTCCTCGGAAAAGCCTTCTTCTGCACCTTTCAAATC
TTCTTCTACGCCATTCGCCCCATGACCGTCTACCGCGTCCCCTTTACAAAACTGCACGTCTTCAACGTCATGGTC
CAACTCCTCTTCGACCTCGCCATCGTCCGCTTCCTCTCCCCCACGGCACTGGCATACCTCATCCTCTCCTCCTTT
CTCGCCGGGAGCCTCCACCCCCTGGCAGCGCACTTCATAGCAGAGCACTACGTCTACGACCTCCCCCAGCATCTA
ACCCGACAGCTCTCCTCCTCCAGCGCGACCCCCGTCCCAGAAACATTCTCCTACTACGGCCCGCTGAACTGGCTC
ACCTACAACGTAGGCCTCCACAACGAACACCACGACTTCCCCGCCATCCCCTGGTCCCGCCTCCCGACGCTGCGC
AGAATCGCGGACGAGTTCTACCGCGACCTGCCCTGCCATACCAGCTGGTCGTATGCGCTTTGGCGCTTCATCTGG
GATGATGGCGTGGGCATGACTTGTCGGGTCAAGAGGGAGAGGGCTAAGAAGGGGAGGTGGGCCGAGTCTGAGGTT
CAGGCTTGA
Gene >Ophun1|4745
ATGACCAATCCCCCCCCAAAAGCCCCCTCAGCCACCCCCCCAGACCACGACTTCATCTGGACCTACACCGAAGAA
CCCCACCGAACCCGCCGCCTCGCCATCATAAAAGCCCACCCCGAAGTAACCAAGCTATGCGGCCCCGAACCTCTG
ACCAAGTACGTCGTCGCCCTGGTCGTGGCCATCCAGGTGACGACGGCATGGCTCCTCTCCAGCAGCGACTTCTGG
ACGCTGCGCTTCTGGCTGGTCGCCTACGTCATCGGCGCGACGGCCAACCAGAATCTCTTCCTGGCCATACACGAG
ATTTCGCATAACTTGGCGTTTCGCTCTCCGCTGGCGAATAGGGTCTTTGCTGTTTTCGCCAATCTACCCATCGGC
GTCCCCTACAGCGCTTCCTTTCGAGTTTGTTTCCCCCACTTGTGTATTTATGGATTGGTTTGCTGATGACGGGTA
GCCTTATCATCTTACCCATCACAAGTCCCTGGGCGTAGATGGCATCGACACCGATCTCCCCACCGCACTCGAAGC
CGTCATCCTCGACTCCCTCCTCGGAAAAGCCTTCTTCTGCACCTTTCAAATCTTCTTCTACGCCATTCGCCCCAT
GACCGTCTACCGCGTCCCCTTTACAAAACTGCACGTCTTCAACGTCATGGTCCAACTCCTCTTCGACCTCGCCAT
CGTCCGCTTCCTCTCCCCCACGGCACTGGCATACCTCATCCTCTCCTCCTTTCTCGCCGGGAGCCTCCACCCCCT
GGCAGCGCACTTCATAGCAGAGCACTACGTCTACGACCTCCCCCAGCATCTAACCCGACAGCTCTCCTCCTCCAG
CGCGACCCCCGTCCCAGAAACATTCTCCTACTACGGCCCGCTGAACTGGCTCACCTACAACGTAGGCCTCCACAA
CGAACACCACGACTTCCCCGCCATCCCCTGGTCCCGCCTCCCGACGCTGCGCAGAATCGCGGACGAGTTCTACCG
CGACCTGCCCTGCCATACCAGCTGGTCGTATGCGCTTTGGCGCTTCATCTGGGATGATGGCGTGGGCATGACTTG
TCGGGTCAAGAGGGAGAGGGCTAAGAAGGGGAGGTGGGCCGAGTCTGAGGTTCAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail