Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4743
Gene name
LocationContig_444:6655..7743
Strand-
Gene length (bp)1088
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00789 UBX UBX domain 2.3E-06 238 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10483|YDFB_SCHPO Uncharacterized protein C17C9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17C9.11c PE=4 SV=2 77 313 4.0E-24
sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 5 314 1.0E-21
sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 3 314 1.0E-20
sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 3 314 1.0E-17
sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 3 314 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10483|YDFB_SCHPO Uncharacterized protein C17C9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17C9.11c PE=4 SV=2 77 313 4.0E-24
sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 5 314 1.0E-21
sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 3 314 1.0E-20
sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 3 314 1.0E-17
sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 3 314 2.0E-16
sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 5 314 5.0E-14
sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=3 SV=2 5 314 4.0E-13
sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 5 314 4.0E-10
sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens GN=UBXN1 PE=1 SV=2 5 314 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4743
MPSDLDQLLDMGFEKARAEMAVKKSGGLQGALQWLEDNQEKSLEEIQEASKDANEDEDEAETRAKIAELETGKAQ
SLVCNECGKRFRNQDLASYHATKTEHTDFSESTEEIAPLTEEEKKAKLDELRERLKAKKAVQSVQDKEDQKRNEK
IRQKATKETQDAKEELQRKEQMKEVARKRQEKAEDMEAKKRIKAKIEADKAERRRKADEAKAARDGKVPEPQPSA
VQTPAAPAAQPRSDRNEARLRLQLASGNITKTLPAGTTLFELAQMVQSETGNAVTSFSTTLPRKTFEGDLDMSKT
LKEAGLVPSSVLIVK*
Coding >Ophun1|4743
ATGCCTTCCGATCTGGACCAGCTGCTCGACATGGGCTTCGAGAAAGCCCGCGCCGAAATGGCCGTGAAAAAATCC
GGTGGCCTCCAAGGCGCTCTGCAGTGGCTGGAGGACAACCAGGAAAAGTCGCTGGAAGAGATTCAAGAAGCTTCC
AAAGATGCCAACGAAGACGAAGACGAGGCCGAGACGAGGGCCAAGATTGCAGAGCTGGAGACTGGCAAGGCTCAA
TCGCTGGTTTGCAACGAGTGTGGCAAGCGTTTCCGCAACCAAGATCTGGCAAGCTACCATGCCACCAAGACAGAA
CACACCGACTTTTCCGAATCGACCGAAGAAATCGCCCCCCTGACCGAAGAGGAGAAAAAGGCCAAGCTGGACGAA
CTCCGAGAGCGCCTCAAGGCCAAAAAGGCCGTACAGTCCGTTCAGGACAAGGAGGATCAGAAACGAAACGAGAAA
ATCCGCCAAAAGGCCACAAAGGAGACGCAAGACGCAAAGGAAGAGCTCCAGCGCAAGGAGCAGATGAAGGAAGTC
GCCCGCAAGCGCCAAGAAAAAGCCGAAGACATGGAGGCCAAGAAGCGCATCAAGGCCAAGATCGAAGCCGACAAG
GCCGAGCGACGCCGCAAGGCTGACGAGGCCAAGGCAGCTCGCGACGGCAAGGTTCCCGAACCGCAGCCGTCTGCG
GTGCAAACTCCGGCTGCTCCCGCCGCACAGCCCAGATCGGACCGCAACGAGGCTAGACTCAGGCTTCAGCTGGCG
TCGGGCAACATTACCAAGACGCTGCCGGCGGGAACGACGTTGTTTGAGCTGGCACAGATGGTTCAGAGCGAGACG
GGAAACGCCGTCACCAGTTTCTCTACGACGCTGCCGCGCAAAACTTTTGAAGGCGACCTCGACATGTCCAAGACG
CTCAAAGAGGCTGGCCTGGTGCCGTCGTCGGTACTCATCGTAAAGTAG
Transcript >Ophun1|4743
ATGCCTTCCGATCTGGACCAGCTGCTCGACATGGGCTTCGAGAAAGCCCGCGCCGAAATGGCCGTGAAAAAATCC
GGTGGCCTCCAAGGCGCTCTGCAGTGGCTGGAGGACAACCAGGAAAAGTCGCTGGAAGAGATTCAAGAAGCTTCC
AAAGATGCCAACGAAGACGAAGACGAGGCCGAGACGAGGGCCAAGATTGCAGAGCTGGAGACTGGCAAGGCTCAA
TCGCTGGTTTGCAACGAGTGTGGCAAGCGTTTCCGCAACCAAGATCTGGCAAGCTACCATGCCACCAAGACAGAA
CACACCGACTTTTCCGAATCGACCGAAGAAATCGCCCCCCTGACCGAAGAGGAGAAAAAGGCCAAGCTGGACGAA
CTCCGAGAGCGCCTCAAGGCCAAAAAGGCCGTACAGTCCGTTCAGGACAAGGAGGATCAGAAACGAAACGAGAAA
ATCCGCCAAAAGGCCACAAAGGAGACGCAAGACGCAAAGGAAGAGCTCCAGCGCAAGGAGCAGATGAAGGAAGTC
GCCCGCAAGCGCCAAGAAAAAGCCGAAGACATGGAGGCCAAGAAGCGCATCAAGGCCAAGATCGAAGCCGACAAG
GCCGAGCGACGCCGCAAGGCTGACGAGGCCAAGGCAGCTCGCGACGGCAAGGTTCCCGAACCGCAGCCGTCTGCG
GTGCAAACTCCGGCTGCTCCCGCCGCACAGCCCAGATCGGACCGCAACGAGGCTAGACTCAGGCTTCAGCTGGCG
TCGGGCAACATTACCAAGACGCTGCCGGCGGGAACGACGTTGTTTGAGCTGGCACAGATGGTTCAGAGCGAGACG
GGAAACGCCGTCACCAGTTTCTCTACGACGCTGCCGCGCAAAACTTTTGAAGGCGACCTCGACATGTCCAAGACG
CTCAAAGAGGCTGGCCTGGTGCCGTCGTCGGTACTCATCGTAAAGTAG
Gene >Ophun1|4743
ATGCCTTCCGATCTGGACCAGCTGCTCGACATGGGCTTCGAGAAAGCCCGCGCCGAAATGGCCGTGAAAAAATCC
GGTGGCCGTGCGTATCCCTACAGCTACCTACGTCACCCCGCTAACGCCGGCTCAGTCCAAGGCGCTCTGCAGTGG
CTGGAGGACAACCAGGAAAAGTCGCTGGAAGAGATTCAAGAAGCTTCCAAAGATGCCAACGAAGACGAAGACGAG
GCCGAGACGAGGGCCAAGATTGCAGAGCTGGAGACTGGCAAGGCTCAATCGCTGGTTTGCAACGAGTGTGGCAAG
CGTTTCCGCAACCAAGATCTGGCAAGCTACCATGCCACCAAGACGTCGGTCACTTGTTTGAAACTGTGATGAGTT
GCTGACCTTTACAGAGAACACACCGACTTTTCCGAATCGACCGAAGAAATCGCCCCCCTGACCGAAGAGGAGAAA
AAGGCCAAGCTGGACGAACTCCGAGAGCGCCTCAAGGCCAAAAAGGCCGTACAGTCCGTTCAGGACAAGGAGGAT
CAGAAACGAAACGAGGTAGACTCCATGCCGCCGCCTACCCGACACACGCTGACGATGACCAGAAAATCCGCCAAA
AGGCCACAAAGGAGACGCAAGACGCAAAGGAAGAGCTCCAGCGCAAGGAGCAGATGAAGGAAGTCGCCCGCAAGC
GCCAAGAAAAAGCCGAAGACATGGAGGCCAAGAAGCGCATCAAGGCCAAGATCGAAGCCGACAAGGCCGAGCGAC
GCCGCAAGGCTGACGAGGCCAAGGCAGCTCGCGACGGCAAGGTTCCCGAACCGCAGCCGTCTGCGGTGCAAACTC
CGGCTGCTCCCGCCGCACAGCCCAGATCGGACCGCAACGAGGCTAGACTCAGGCTTCAGCTGGCGTCGGGCAACA
TTACCAAGACGCTGCCGGCGGGAACGACGTTGTTTGAGCTGGCACAGATGGTTCAGAGCGAGACGGGAAACGCCG
TCACCAGTTTCTCTACGACGCTGCCGCGCAAAACTTTTGAAGGCGACCTCGACATGTCCAAGACGCTCAAAGAGG
CTGGCCTGGTGCCGTCGTCGGTACTCATCGTAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail