Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4730
Gene name
LocationContig_442:11352..11752
Strand-
Gene length (bp)400
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12907 zf-met2 Zinc-binding 5.9E-16 35 70
PF04419 4F5 4F5 protein related disordered region 3.2E-06 1 32

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64818|Y2309_ARATH Uncharacterized protein At2g23090 OS=Arabidopsis thaliana GN=At2g23090 PE=1 SV=1 2 69 3.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6052
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4415
Ophiocordyceps camponoti-floridani Ophcf2|02247
Ophiocordyceps camponoti-rufipedis Ophun1|4730 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2043

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4730
MGNGAKAQQKRERSQKDGKAAKSQLKVNEQAKSIQCQICKATFLQTTKAPALLEHASNKHSKGLTDCFPGSNS*
Coding >Ophun1|4730
ATGGGCAACGGAGCCAAGGCGCAACAGAAGCGCGAGCGCAGCCAAAAGGATGGCAAAGCCGCAAAGTCGCAGCTC
AAAGTCAACGAACAGGCCAAGAGCATCCAATGCCAGATCTGCAAGGCCACCTTTCTCCAGACGACCAAGGCTCCA
GCGTTACTGGAGCATGCCTCCAACAAACACTCCAAGGGCCTGACCGACTGCTTCCCCGGCTCCAATAGCTGA
Transcript >Ophun1|4730
ATGGGCAACGGAGCCAAGGCGCAACAGAAGCGCGAGCGCAGCCAAAAGGATGGCAAAGCCGCAAAGTCGCAGCTC
AAAGTCAACGAACAGGCCAAGAGCATCCAATGCCAGATCTGCAAGGCCACCTTTCTCCAGACGACCAAGGCTCCA
GCGTTACTGGAGCATGCCTCCAACAAACACTCCAAGGGCCTGACCGACTGCTTCCCCGGCTCCAATAGCTGA
Gene >Ophun1|4730
ATGGGCAACGTGAGTCTTTGCGACGCCTCTGCCTCACCACCATCGACCTGCTGACCGCCCTTCGCCCTTCAGGGA
GCCAAGGCGCAACAGAAGCGCGAGCGCAGCCAAAAGGATGGCAAAGCCGCAAAGTCGCAGCTCAAAGTCGTTCGT
CAGCCCGCATCTCCGCGCCCTCTTGTTTGTGGACGAGAAATAACTCGTGGCCGACAGAACGAACAGGCCAAGAGC
ATCCAATGCCAGATCTGCAAGGCCACCTTTCTCCAGACGACCAAGGCTCCAGCGTCCGTCGCCGCCGCCGCTTGC
TCTCTTCTCGCTGACCTGACATGTGACTAGGTTACTGGAGCATGCCTCCAACAAACACTCCAAGGGCCTGACCGA
CTGCTTCCCCGGCTCCAATAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail