Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4729
Gene name
LocationContig_442:10040..11205
Strand+
Gene length (bp)1165
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal 8.7E-33 6 127
PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily 7.6E-13 195 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 3 292 7.0E-32
sp|Q8H113|DIN11_ARATH Probable 2-oxoglutarate-dependent dioxygenase DIN11 OS=Arabidopsis thaliana GN=DIN11 PE=2 SV=1 10 290 1.0E-30
sp|F4IY03|DIOX1_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g49630 PE=3 SV=1 6 290 1.0E-27
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 1 292 2.0E-27
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 6 277 5.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 3 292 7.0E-32
sp|Q8H113|DIN11_ARATH Probable 2-oxoglutarate-dependent dioxygenase DIN11 OS=Arabidopsis thaliana GN=DIN11 PE=2 SV=1 10 290 1.0E-30
sp|F4IY03|DIOX1_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g49630 PE=3 SV=1 6 290 1.0E-27
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 1 292 2.0E-27
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 6 277 5.0E-26
sp|A6BM06|ACCO1_DICMU 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium mucoroides GN=aco PE=3 SV=1 6 277 5.0E-26
sp|Q9SQ80|G2OX1_PEA Gibberellin 2-beta-dioxygenase 1 OS=Pisum sativum GN=GA2OX1 PE=1 SV=1 4 279 3.0E-18
sp|Q39224|SRG1_ARATH Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1 6 280 7.0E-17
sp|D4N502|DIOX3_PAPSO Codeine O-demethylase OS=Papaver somniferum GN=CODM PE=1 SV=1 5 319 9.0E-17
sp|D4N501|DIOX2_PAPSO Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase OS=Papaver somniferum GN=DIOX2 PE=2 SV=1 5 286 2.0E-15
sp|Q8LEA2|G2OX1_ARATH Gibberellin 2-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA2OX1 PE=2 SV=2 3 279 3.0E-15
sp|A2A1A0|NCS1_COPJA S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1 6 337 6.0E-15
sp|P10621|IPNS_STRC2 Isopenicillin N synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pcbC PE=3 SV=1 1 277 3.0E-14
sp|Q9XFR9|G2OX2_ARATH Gibberellin 2-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA2OX2 PE=2 SV=1 5 279 1.0E-13
sp|P18286|IPNS_STRJU Isopenicillin N synthase OS=Streptomyces jumonjinensis GN=pcbC PE=3 SV=1 1 313 1.0E-13
sp|Q40062|IDS3_HORVU 2'-deoxymugineic-acid 2'-dioxygenase OS=Hordeum vulgare GN=IDS3 PE=1 SV=3 2 266 2.0E-13
sp|Q9C6I4|G2OX7_ARATH Gibberellin 2-beta-dioxygenase 7 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=1 6 277 3.0E-13
sp|Q9C955|GAOX4_ARATH Gibberellin 20 oxidase 4 OS=Arabidopsis thaliana GN=GA20OX4 PE=2 SV=1 6 283 4.0E-13
sp|Q9XG83|G2OX_PHACN Gibberellin 2-beta-dioxygenase OS=Phaseolus coccineus GN=GA2OX1 PE=2 SV=1 3 292 5.0E-13
sp|O48882|ACCO2_MALDO 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Malus domestica GN=ACO2 PE=2 SV=1 5 277 7.0E-13
sp|Q84TC2|BX6_MAIZE DIBOA-glucoside dioxygenase BX6 OS=Zea mays GN=BX6 PE=1 SV=1 4 277 7.0E-13
sp|Q9C7Z1|G2OX4_ARATH Gibberellin 2-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA2OX4 PE=2 SV=1 6 279 1.0E-12
sp|Q00985|ACCO1_MALDO 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Malus domestica PE=1 SV=1 5 277 1.0E-12
sp|Q9XHM5|G2OX2_PEA Gibberellin 2-beta-dioxygenase 2 OS=Pisum sativum GN=GA2OX2 PE=2 SV=1 6 277 1.0E-12
sp|Q9LHN8|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1 OS=Arabidopsis thaliana GN=F6'H1 PE=1 SV=1 5 277 2.0E-12
sp|Q9C899|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2 OS=Arabidopsis thaliana GN=F6'H2 PE=1 SV=1 5 277 2.0E-12
sp|Q0WPW4|ACCO5_ARATH 1-aminocyclopropane-1-carboxylate oxidase 5 OS=Arabidopsis thaliana GN=At1g77330 PE=2 SV=1 5 284 2.0E-12
sp|Q05963|FL3H_CALCH Naringenin,2-oxoglutarate 3-dioxygenase OS=Callistephus chinensis GN=FHT PE=2 SV=1 4 279 2.0E-12
sp|Q06588|ACCO4_ARATH 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Arabidopsis thaliana GN=ACO4 PE=1 SV=2 5 277 5.0E-12
sp|Q04644|ACCO1_CUCME 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Cucumis melo GN=ACO1 PE=2 SV=1 6 284 9.0E-12
sp|Q84MB3|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1 5 277 1.0E-11
sp|Q8S932|ACCO_DIOKA 1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1 5 284 1.0E-11
sp|P40902|ISP7_SCHPO Sexual differentiation process protein isp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp7 PE=2 SV=1 121 277 2.0E-11
sp|O24648|G3OX_PEA Gibberellin 3-beta-dioxygenase 1 OS=Pisum sativum GN=LE PE=1 SV=1 2 279 2.0E-11
sp|Q9FR99|ACCO_MUSAC 1-aminocyclopropane-1-carboxylate oxidase OS=Musa acuminata GN=MAO1B PE=3 SV=1 5 277 3.0E-11
sp|Q9LTH8|ACH11_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 11 OS=Arabidopsis thaliana GN=At5g59530 PE=2 SV=1 6 292 4.0E-11
sp|O64692|G2OX3_ARATH Gibberellin 2-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA2OX3 PE=2 SV=1 6 279 8.0E-11
sp|Q9M2C4|ACCH8_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 8 OS=Arabidopsis thaliana GN=At3g61400 PE=2 SV=1 5 277 8.0E-11
sp|P27744|IPNS_AMYLA Isopenicillin N synthase OS=Amycolatopsis lactamdurans GN=pcbC PE=3 SV=1 1 277 1.0E-10
sp|Q03047|CEFE_AMYLA Deacetoxycephalosporin C synthase OS=Amycolatopsis lactamdurans GN=cefE PE=3 SV=1 1 266 1.0E-10
sp|Q09052|ACCO1_BRAJU 1-aminocyclopropane-1-carboxylate oxidase OS=Brassica juncea GN=ACO PE=2 SV=1 27 286 2.0E-10
sp|Q54243|IPNS_STRGR Isopenicillin N synthase OS=Streptomyces griseus GN=pcbC PE=3 SV=1 18 277 3.0E-10
sp|P31237|ACCO_ACTDE 1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1 5 284 4.0E-10
sp|Q9FZ21|G2OX6_ARATH Gibberellin 2-beta-dioxygenase 6 OS=Arabidopsis thaliana GN=GA2OX6 PE=2 SV=1 5 289 5.0E-10
sp|Q9M547|FLS_EUSER Flavonol synthase/flavanone 3-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=FLS PE=2 SV=1 6 277 5.0E-10
sp|Q41931|ACCO2_ARATH 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Arabidopsis thaliana GN=ACO2 PE=2 SV=2 6 286 7.0E-10
sp|O65378|ACCO3_ARATH 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Arabidopsis thaliana GN=At1g12010 PE=2 SV=1 6 286 8.0E-10
sp|Q08507|ACCO3_PETHY 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Petunia hybrida GN=ACO3 PE=3 SV=1 5 284 1.0E-09
sp|Q43792|ACCO_TOBAC 1-aminocyclopropane-1-carboxylate oxidase OS=Nicotiana tabacum GN=ACO PE=2 SV=1 5 284 2.0E-09
sp|O04847|DV4H_CATRO Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2 6 281 2.0E-09
sp|Q08506|ACCO1_PETHY 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1 5 284 3.0E-09
sp|Q07353|FL3H_PETHY Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Petunia hybrida GN=AN3 PE=1 SV=1 6 279 3.0E-09
sp|P41213|LDOX_MAIZE Leucoanthocyanidin dioxygenase OS=Zea mays GN=A2 PE=2 SV=1 6 262 4.0E-09
sp|P12438|IPNS_STRMI Isopenicillin N synthase OS=Streptomyces microflavus GN=pcbC PE=3 SV=1 1 277 5.0E-09
sp|Q9LTH7|ACH12_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 12 OS=Arabidopsis thaliana GN=At5g59540 PE=2 SV=1 6 277 5.0E-09
sp|Q0JH50|GAOX2_ORYSJ Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. japonica GN=20ox2 PE=1 SV=1 35 262 6.0E-09
sp|P0C5H5|GAOX2_ORYSI Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. indica GN=20ox2 PE=1 SV=1 35 262 6.0E-09
sp|Q39110|GAOX1_ARATH Gibberellin 20 oxidase 1 OS=Arabidopsis thaliana GN=GA20OX1 PE=2 SV=2 6 277 9.0E-09
sp|Q9FFQ4|FLS5_ARATH Probable flavonol synthase 5 OS=Arabidopsis thaliana GN=FLS5 PE=2 SV=1 2 299 1.0E-08
sp|Q9SVS8|G3OX3_ARATH Gibberellin 3-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA3OX3 PE=2 SV=1 6 279 1.0E-08
sp|Q9LSW6|ACH10_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 10 OS=Arabidopsis thaliana GN=At5g43450 PE=2 SV=1 5 277 2.0E-08
sp|P05116|ACCO1_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Solanum lycopersicum GN=ACO1 PE=2 SV=2 5 284 3.0E-08
sp|Q9ZWQ9|FLS_CITUN Flavonol synthase/flavanone 3-hydroxylase OS=Citrus unshiu GN=FLS PE=1 SV=1 6 277 3.0E-08
sp|Q08508|ACCO4_PETHY 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Petunia hybrida GN=ACO4 PE=3 SV=1 5 284 4.0E-08
sp|P11935|EXPA_ACRCH Cephalosporin biosynthesis expandase/hydroxylase OS=Acremonium chrysogenum GN=CEFEF PE=3 SV=1 4 265 5.0E-08
sp|P93824|ACCH6_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 6 OS=Arabidopsis thaliana GN=At1g04350 PE=2 SV=1 5 277 6.0E-08
sp|P42220|CEFF_STRCL Deacetoxycephalosporin C hydroxylase OS=Streptomyces clavuligerus GN=cefF PE=1 SV=3 1 267 7.0E-08
sp|P24157|ACCO4_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Solanum lycopersicum GN=ACO4 PE=2 SV=1 5 284 8.0E-08
sp|Q9MB94|ACCO_PRUMU 1-aminocyclopropane-1-carboxylate oxidase OS=Prunus mume GN=ACO1 PE=2 SV=1 5 284 1.0E-07
sp|P42219|CEFF_AMYLA Deacetoxycephalosporin C hydroxylase OS=Amycolatopsis lactamdurans GN=cefF PE=3 SV=1 1 266 2.0E-07
sp|P31238|ACCO1_DORSP 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Doritaenopsis sp. GN=ACO1 PE=2 SV=1 134 284 6.0E-07
sp|O04274|LDOX_PERFR Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1 6 262 7.0E-07
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 1 277 8.0E-07
sp|Q39111|GAOX2_ARATH Gibberellin 20 oxidase 2 OS=Arabidopsis thaliana GN=GA20OX2 PE=2 SV=1 27 277 1.0E-06
sp|Q41452|FLS_SOLTU Flavonol synthase/flavanone 3-hydroxylase OS=Solanum tuberosum PE=2 SV=1 6 277 1.0E-06
sp|Q39112|GAOX3_ARATH Gibberellin 20 oxidase 3 OS=Arabidopsis thaliana GN=GA20OX3 PE=2 SV=1 30 262 1.0E-06
sp|Q8H1S4|ACCH3_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 3 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1 1 281 1.0E-06
sp|P93821|ACCH7_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 7 OS=Arabidopsis thaliana GN=At1g04380 PE=1 SV=1 5 277 2.0E-06
sp|Q96330|FLS1_ARATH Flavonol synthase/flavanone 3-hydroxylase OS=Arabidopsis thaliana GN=FLS1 PE=1 SV=1 5 277 2.0E-06
sp|Q9XHG2|FLS_MALDO Flavonol synthase/flavanone 3-hydroxylase OS=Malus domestica GN=FLS PE=2 SV=1 6 277 2.0E-06
sp|Q40061|IDS2_HORVU Mugineic-acid 3-dioxygenase OS=Hordeum vulgare GN=IDS2 PE=2 SV=1 4 277 3.0E-06
sp|Q9C971|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA3OX4 PE=1 SV=1 5 279 4.0E-06
sp|P51091|LDOX_MALDO Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1 6 260 5.0E-06
sp|P10967|ACCH3_SOLLC 1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1 6 279 8.0E-06
sp|Q8XPV7|EFE_RALSO 2-oxoglutarate-dependent ethylene/succinate-forming enzyme OS=Ralstonia solanacearum (strain GMI1000) GN=efe PE=3 SV=1 55 290 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4729
MSFTSIPVLDLDLARQPETKASFLDELRHALMEVGFFYLKNVGIPPRLCESVVDKGKDFFDLPLQEKLKIEMKNA
PSFLGYSRLSAEITAGKADHREQLDLSTEHPLPEPGSPPYHNLLAPNQWPAEEAAPGFRTTYTEYMRRMGDMSMY
FTSLIAEAIQLPADAFDKYFDRDQQHKLKIVKYPDLAELGVDGQGQGVGPHKDSMLTSYLLQATSHRGLQVQNVG
GEWIDCPPMDGTLVVAIGQGMEALTQGVCVSTTHRVLSPAAGSGPRFSIPFFQGVRFDAEFEELETVGVGIVPES
VKAQRRAIMERNGGRLDDVEFTFTRGSAARTLGEATLRNRVKSHPDVGERWYPDILKSIREEQAKARRRL*
Coding >Ophun1|4729
ATGTCGTTTACGTCGATTCCCGTTTTGGACTTGGACCTTGCTCGCCAGCCAGAGACCAAGGCCAGTTTCCTCGAT
GAGCTCCGCCATGCCCTGATGGAGGTGGGCTTCTTCTATCTCAAGAACGTAGGCATTCCGCCTCGGCTATGCGAG
TCCGTCGTCGACAAGGGCAAGGACTTCTTTGATCTGCCGCTGCAAGAAAAACTGAAGATTGAGATGAAGAATGCG
CCGTCTTTTCTGGGCTACTCCAGGCTGTCGGCCGAGATTACGGCCGGCAAGGCGGACCATCGCGAGCAGCTAGAC
CTTTCCACCGAGCACCCGCTGCCAGAGCCCGGATCGCCGCCATATCACAATCTCCTCGCTCCGAACCAGTGGCCG
GCCGAGGAGGCCGCGCCGGGTTTCCGGACGACTTATACGGAATACATGCGGCGTATGGGCGACATGTCGATGTAC
TTTACGTCGCTAATCGCCGAGGCCATCCAGCTTCCGGCCGATGCCTTTGACAAGTACTTTGACCGGGATCAGCAG
CATAAGCTCAAGATTGTCAAGTATCCGGACCTGGCCGAGCTGGGCGTCGACGGACAGGGCCAGGGAGTCGGCCCG
CACAAGGACAGCATGCTGACGAGCTATCTGCTCCAGGCGACGTCGCACCGCGGGCTTCAGGTGCAGAATGTCGGC
GGAGAGTGGATCGACTGCCCGCCCATGGATGGGACGCTGGTTGTGGCCATCGGGCAGGGGATGGAGGCGTTGACG
CAGGGCGTGTGCGTGTCGACGACGCACCGGGTGTTGTCACCGGCCGCAGGCTCTGGTCCACGATTCTCCATCCCC
TTCTTTCAGGGCGTCAGGTTCGATGCCGAATTCGAAGAGCTGGAGACTGTCGGCGTCGGCATCGTGCCGGAAAGC
GTCAAGGCTCAGAGGAGGGCCATCATGGAGCGCAACGGTGGCAGGTTGGACGACGTCGAGTTTACGTTTACTAGA
GGCTCGGCGGCGCGGACTCTAGGCGAGGCGACTCTACGGAACCGCGTCAAGAGCCATCCGGATGTCGGAGAGAGG
TGGTATCCGGACATTCTGAAGAGCATCCGCGAGGAGCAGGCCAAGGCGAGGCGAAGACTGTAG
Transcript >Ophun1|4729
ATGTCGTTTACGTCGATTCCCGTTTTGGACTTGGACCTTGCTCGCCAGCCAGAGACCAAGGCCAGTTTCCTCGAT
GAGCTCCGCCATGCCCTGATGGAGGTGGGCTTCTTCTATCTCAAGAACGTAGGCATTCCGCCTCGGCTATGCGAG
TCCGTCGTCGACAAGGGCAAGGACTTCTTTGATCTGCCGCTGCAAGAAAAACTGAAGATTGAGATGAAGAATGCG
CCGTCTTTTCTGGGCTACTCCAGGCTGTCGGCCGAGATTACGGCCGGCAAGGCGGACCATCGCGAGCAGCTAGAC
CTTTCCACCGAGCACCCGCTGCCAGAGCCCGGATCGCCGCCATATCACAATCTCCTCGCTCCGAACCAGTGGCCG
GCCGAGGAGGCCGCGCCGGGTTTCCGGACGACTTATACGGAATACATGCGGCGTATGGGCGACATGTCGATGTAC
TTTACGTCGCTAATCGCCGAGGCCATCCAGCTTCCGGCCGATGCCTTTGACAAGTACTTTGACCGGGATCAGCAG
CATAAGCTCAAGATTGTCAAGTATCCGGACCTGGCCGAGCTGGGCGTCGACGGACAGGGCCAGGGAGTCGGCCCG
CACAAGGACAGCATGCTGACGAGCTATCTGCTCCAGGCGACGTCGCACCGCGGGCTTCAGGTGCAGAATGTCGGC
GGAGAGTGGATCGACTGCCCGCCCATGGATGGGACGCTGGTTGTGGCCATCGGGCAGGGGATGGAGGCGTTGACG
CAGGGCGTGTGCGTGTCGACGACGCACCGGGTGTTGTCACCGGCCGCAGGCTCTGGTCCACGATTCTCCATCCCC
TTCTTTCAGGGCGTCAGGTTCGATGCCGAATTCGAAGAGCTGGAGACTGTCGGCGTCGGCATCGTGCCGGAAAGC
GTCAAGGCTCAGAGGAGGGCCATCATGGAGCGCAACGGTGGCAGGTTGGACGACGTCGAGTTTACGTTTACTAGA
GGCTCGGCGGCGCGGACTCTAGGCGAGGCGACTCTACGGAACCGCGTCAAGAGCCATCCGGATGTCGGAGAGAGG
TGGTATCCGGACATTCTGAAGAGCATCCGCGAGGAGCAGGCCAAGGCGAGGCGAAGACTGTAG
Gene >Ophun1|4729
ATGTCGTTTACGTCGATTCCCGTTTTGGACTTGGACCTTGCTCGCCAGCCAGAGACCAAGGCCAGTTTCCTCGAT
GAGCTCCGCCATGCCCTGATGGAGGTGGGCTTCTTCTATCTCAAGAACGTAGGCATTCCGCCTCGGCTATGCGAG
TCCGTCGTCGACAAGGGCAAGGACTTCTTTGATCTGCCGCTGCAAGAAAAGTACACCGTCGCTCCAGCTCCGCCA
AGTCAGATTCTCATGTCGGGATCGCAGACTGAAGATTGAGATGAAGAATGCGCCGTCTTTTCTGGGCTACTCCAG
GCTGTCGGCCGAGATTACGGCCGGCAAGGCGGACCATCGCGAGCAGCTAGACCTTTCCACCGAGCACCCGCTGCC
AGAGCCCGGATCGCCGCCATATCACAATCTCCTCGCTCCGAACCAGTGGCCGGCCGAGGAGGCCGCGCCGGGTTT
CCGGACGACTTATACGGAATACATGCGGCGTATGGGCGACATGTCGATGTACTTTACGTCGCTAATCGCCGAGGC
CATCCAGCTTCCGGCCGATGCCTTTGACAAGTACTTTGACCGGGATCAGCAGCATAAGCTCAAGATTGTCAAGTA
TCCGGACCTGGCCGAGCTGGGCGTCGACGGACAGGGCCAGGGAGTCGGCCCGCACAAGGACAGCATGCTGACGAG
CTATCTGCTCCAGGCGACGTCGCACCGCGGGCTTCAGGTGCAGAATGTCGGCGGAGAGTGGATCGACTGCCCGCC
CATGGATGGGACGCTGGTTGTGGCCATCGGGCAGGGGATGGAGGCGTTGACGCAGGGCGTGTGCGTGTCGACGAC
GCACCGGGTGTTGTCACCGGCCGCAGGCTCTGGTCCACGATTCTCCATCCCCTTCTTTCAGGGCGTCAGGTTCGA
TGCCGAATTCGAAGAGCTGGAGACTGTCGGCGTCGGCATCGTGCCGGAAAGCGTCAAGGCTCAGAGGAGGGCCAT
CATGGAGCGCAACGGTGGCAGGTTGGACGACGTCGAGTTTACGTTTACTAGAGGCTCGGCGGCGCGGACTCTAGG
CGAGGCGACTCTACGGAACCGCGTCAAGAGCCATCCGGATGTCGGAGAGAGGTGGTATCCGGACATTCTGAAGAG
CATCCGCGAGGAGCAGGCCAAGGCGAGGCGAAGACTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail