Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4719
Gene name
LocationContig_441:0..775
Strand-
Gene length (bp)775
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09816 EAF RNA polymerase II transcription elongation factor 7.3E-21 13 114

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4719
MAALIDPTIRGKYPVILGEGMLGKTSNDIFTGVRYNHKPSLSSADGPAHARLKPSQPGKTTSYDLSYSDGGAAYA
YAGTRSIDTNQFVLHFDPDRKAFILDRIDSTFNMNLTRLPGTSDSAKLARQFPHIDAQQTKPAATESKPQHASSP
ALPTPSSAPPPTSAPTSGKPAKTSTAKGRRPVSTQARAHTSGTGTSAQEKGTGQAGPARRGRGRG*
Coding >Ophun1|4719
ATGGCGGCGCTGATCGATCCCACCATCCGTGGGAAATACCCCGTCATTCTGGGCGAGGGGATGCTGGGGAAGACG
TCCAATGACATCTTTACCGGCGTACGATACAACCACAAACCCAGCTTGTCGTCGGCAGACGGTCCCGCTCATGCT
CGTCTCAAGCCTTCGCAGCCTGGGAAGACGACGTCTTACGATCTGTCGTATAGCGATGGGGGCGCCGCCTACGCA
TACGCCGGCACCCGCTCCATCGACACCAACCAGTTCGTCCTGCACTTCGATCCCGACCGAAAAGCCTTCATCCTC
GATAGGATCGACTCTACTTTCAACATGAACCTGACCCGTCTACCGGGCACTTCGGATTCGGCCAAGCTCGCCCGT
CAGTTCCCTCACATCGACGCCCAACAAACGAAGCCAGCCGCTACCGAGAGCAAGCCGCAACACGCTTCATCTCCC
GCTCTCCCTACCCCTTCCTCCGCCCCTCCTCCTACTTCCGCTCCGACCTCCGGCAAGCCCGCCAAGACGTCCACC
GCCAAAGGCCGTCGGCCTGTCTCTACCCAAGCCCGAGCCCACACCTCCGGCACCGGCACCAGCGCCCAAGAAAAA
GGCACCGGTCAAGCCGGCCCAGCGAGACGAGGACGAGGACGAGGATGA
Transcript >Ophun1|4719
ATGGCGGCGCTGATCGATCCCACCATCCGTGGGAAATACCCCGTCATTCTGGGCGAGGGGATGCTGGGGAAGACG
TCCAATGACATCTTTACCGGCGTACGATACAACCACAAACCCAGCTTGTCGTCGGCAGACGGTCCCGCTCATGCT
CGTCTCAAGCCTTCGCAGCCTGGGAAGACGACGTCTTACGATCTGTCGTATAGCGATGGGGGCGCCGCCTACGCA
TACGCCGGCACCCGCTCCATCGACACCAACCAGTTCGTCCTGCACTTCGATCCCGACCGAAAAGCCTTCATCCTC
GATAGGATCGACTCTACTTTCAACATGAACCTGACCCGTCTACCGGGCACTTCGGATTCGGCCAAGCTCGCCCGT
CAGTTCCCTCACATCGACGCCCAACAAACGAAGCCAGCCGCTACCGAGAGCAAGCCGCAACACGCTTCATCTCCC
GCTCTCCCTACCCCTTCCTCCGCCCCTCCTCCTACTTCCGCTCCGACCTCCGGCAAGCCCGCCAAGACGTCCACC
GCCAAAGGCCGTCGGCCTGTCTCTACCCAAGCCCGAGCCCACACCTCCGGCACCGGCACCAGCGCCCAAGAAAAA
GGCACCGGTCAAGCCGGCCCAGCGAGACGAGGACGAGGACGAGGATGA
Gene >Ophun1|4719
ATGGCGGCGCTGATCGATCCCACCATCCGTGGGAAATACCCCGTCATTCTGGGCGAGGGGATGCTGGGGAAGACG
TCCAATGACATCTTTACCGGCGTACGATGTGCGTTGCGCCCTTGGACGCGTTCCCTACACGCATCGTCTTCCCTT
GGCTGACTGGACAAGACAACCACAAACCCAGCTTGTCGTCGGCAGACGGTCCCGCTCATGCTCGTCTCAAGCCTT
CGCAGCCTGGGAAGACGACGTCTTACGATCTGTCGTATAGCGATGGGGGCGCCGCCTACGCATACGCCGGCACCC
GCTCCATCGACACCAACCAGTTCGTCCTGCACTTCGATCCCGACCGAAAAGCCTTCATCCTCGATAGGATCGACT
CTACTTTCAACATGAACCTGACCCGTCTACCGGGCACTTCGGATTCGGCCAAGCTCGCCCGTCAGTTCCCTCACA
TCGACGCCCAACAAACGAAGCCAGCCGCTACCGAGAGCAAGCCGCAACACGCTTCATCTCCCGCTCTCCCTACCC
CTTCCTCCGCCCCTCCTCCTACTTCCGCTCCGACCTCCGGCAAGCCCGCCAAGACGTCCACCGCCAAAGGTTCCG
CCAGCAAGCCCTCAGCCGCCCACCCGCCCAGACGCAAAGCCGACAAGCCGCAACAAAAGGCCGTCGGCCTGTCTC
TACCCAAGCCCGAGCCCACACCTCCGGCACCGGCACCAGCGCCCAAGAAAAAGGCACCGGTCAAGCCGGCCCAGC
GAGACGAGGACGAGGACGAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail