Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4717
Gene name
LocationContig_440:10315..13102
Strand+
Gene length (bp)2787
Transcript length (bp)1968
Coding sequence length (bp)1968
Protein length (aa) 656

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01067 Calpain_III Calpain large subunit, domain III 3.3E-05 425 534

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZP7|PALB_NEUCR Calpain-like protease palB/cpr-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr-8 PE=3 SV=3 188 612 3.0E-107
sp|Q9Y6Z8|PALB_ASPOR Calpain-like protease palB/RIM13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palB PE=3 SV=1 186 644 3.0E-89
sp|Q00204|PALB_EMENI Calpain-like protease palB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palB PE=3 SV=2 186 649 2.0E-82
sp|Q7RZP7|PALB_NEUCR Calpain-like protease palB/cpr-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr-8 PE=3 SV=3 1 183 6.0E-33
sp|P0CQ06|PALB_CRYNJ Calpain-like protease palB/RIM13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RIM13 PE=3 SV=1 200 568 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZP7|PALB_NEUCR Calpain-like protease palB/cpr-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr-8 PE=3 SV=3 188 612 3.0E-107
sp|Q9Y6Z8|PALB_ASPOR Calpain-like protease palB/RIM13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palB PE=3 SV=1 186 644 3.0E-89
sp|Q00204|PALB_EMENI Calpain-like protease palB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palB PE=3 SV=2 186 649 2.0E-82
sp|Q7RZP7|PALB_NEUCR Calpain-like protease palB/cpr-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr-8 PE=3 SV=3 1 183 6.0E-33
sp|P0CQ06|PALB_CRYNJ Calpain-like protease palB/RIM13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RIM13 PE=3 SV=1 200 568 2.0E-26
sp|P0CQ07|PALB_CRYNB Calpain-like protease palB/RIM13 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RIM13 PE=3 SV=1 200 568 2.0E-26
sp|Q9HFC8|PALB_YARLI Calpain-like protease palB/RIM13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM13 PE=3 SV=1 188 553 3.0E-26
sp|Q9Y6W3|CAN7_HUMAN Calpain-7 OS=Homo sapiens GN=CAPN7 PE=1 SV=1 188 545 2.0E-25
sp|A0FKG7|CAN7_PIG Calpain-7 OS=Sus scrofa GN=CAPN7 PE=2 SV=1 188 540 7.0E-24
sp|Q9R1S8|CAN7_MOUSE Calpain-7 OS=Mus musculus GN=Capn7 PE=2 SV=1 188 540 9.0E-24
sp|Q9Y6Z8|PALB_ASPOR Calpain-like protease palB/RIM13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palB PE=3 SV=1 15 180 2.0E-20
sp|Q6BH66|PALB_DEBHA Calpain-like protease palB/RIM13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G20988g PE=3 SV=2 166 539 3.0E-20
sp|Q00204|PALB_EMENI Calpain-like protease palB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palB PE=3 SV=2 1 175 1.0E-19
sp|Q5AK25|PALB_CANAL Calpain-like protease palB/RIM13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM13 PE=3 SV=1 173 546 1.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4967
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|269
Ophiocordyceps australis map64 (Brazil) OphauB2|4062
Ophiocordyceps camponoti-floridani Ophcf2|04254
Ophiocordyceps camponoti-rufipedis Ophun1|4717 (this protein)
Ophiocordyceps kimflemingae Ophio5|8235
Ophiocordyceps subramaniannii Hirsu2|2039

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4717
MERRAQAAEASFARSSGRIALEHAIRAAELYMKAAGETSDKAQATHLRSKCQELIALAEKLKKRQETATTPPQSD
ILLGVLRLHGNDFPPWHGDPDDDEFELNPGSQYYTDEAPFTLSATQAQNFKAWTRPAELFGLAPDRDKSLDEDIL
MQVHEHCDLVQDITTDCSVVASLSAAAKVMVGPHAVCTGRISAEEERLMGLIGEHDYAVEDLHSPDGNTRKLLIK
NPWRDAPLIVGTGGPDTGRDNTTWITLEDVAQHFETMYLNWNPSLFNCRQDHHLTWELPPNYLATSLVKNPQYSL
SSSTGGSIWILVGRHFVDAELEIARSRRGSLAAVARQLGFMSILVFDNGGKRAHVSGPEIYRGPYVDSPQTLARL
EASPGKRYTIVIDQHELPLPSYSLTLTLFSNSPLEVKLAEERMHHNLERTGAWSRRNAGGNSSKATYYRNPQYKL
VASRSTPVSILLSTDNREVQVHVDVVWARGQRVTSIRVKDLVFSSGEYHRGCAMATIPMLESGTYTLVCSTFDAG
QTAAFAIQVSSMSPLSLDPLPAEAAGRLRTTLGTFNPVRGEGGARASLTASWLTRASISVYNVQLPDAANGARHA
SSVLLRVSVVQGWGSEQVTVAISGDGQFREPTTDLRTGDFDMEPDKVQREDNEVK*
Coding >Ophun1|4717
ATGGAGAGGAGGGCTCAGGCCGCTGAGGCTTCATTCGCTCGATCAAGCGGCAGAATCGCCCTTGAGCATGCGATT
CGGGCCGCGGAGCTTTACATGAAAGCCGCTGGCGAAACTTCAGACAAGGCACAGGCCACTCATCTGAGGAGCAAA
TGCCAGGAACTGATTGCTCTCGCGGAAAAGCTGAAGAAGAGGCAAGAGACGGCAACGACGCCACCCCAGTCAGAC
ATTCTGCTTGGCGTCCTGCGCCTTCATGGGAACGATTTTCCGCCGTGGCATGGTGATCCCGACGATGACGAATTC
GAGCTCAACCCTGGCTCGCAATACTATACAGATGAAGCACCGTTCACGCTATCGGCAACCCAGGCGCAAAACTTC
AAAGCATGGACCAGACCGGCGGAACTCTTTGGACTTGCGCCTGACCGCGACAAAAGTCTAGATGAAGACATCTTG
ATGCAGGTTCATGAGCACTGCGATCTAGTCCAGGACATAACAACAGACTGCTCTGTTGTCGCCAGTCTTTCTGCA
GCTGCAAAGGTCATGGTCGGGCCCCATGCGGTATGCACTGGCCGAATCTCTGCGGAGGAAGAGCGACTCATGGGA
CTCATCGGCGAGCATGACTACGCAGTGGAGGACCTTCACTCGCCTGACGGCAATACACGCAAGCTACTCATCAAG
AATCCTTGGCGCGACGCGCCCTTGATCGTAGGAACTGGAGGTCCAGACACTGGTCGCGACAACACGACTTGGATA
ACGCTGGAGGACGTGGCTCAACACTTCGAGACCATGTACCTGAATTGGAATCCTAGCTTATTCAACTGTCGGCAG
GATCACCATCTGACGTGGGAGTTGCCTCCCAACTATCTTGCGACCTCATTGGTCAAAAATCCCCAATACTCTCTG
TCGTCCTCTACCGGCGGCTCCATATGGATTCTGGTTGGTCGTCACTTCGTGGACGCTGAGCTCGAAATCGCTCGC
AGCAGACGTGGCTCTCTGGCCGCAGTCGCGCGACAACTGGGATTCATGAGCATTCTGGTCTTCGACAACGGTGGC
AAGAGAGCTCATGTAAGTGGGCCGGAAATCTATCGCGGTCCCTACGTCGACTCCCCGCAGACACTCGCGCGTCTT
GAGGCAAGTCCCGGAAAGAGGTACACAATAGTCATCGATCAGCATGAGCTGCCTCTGCCCAGCTATTCTTTGACC
TTGACACTTTTCTCCAACTCGCCACTGGAAGTCAAGCTAGCAGAAGAGAGAATGCACCACAACTTGGAGCGCACA
GGGGCCTGGAGCAGACGTAACGCTGGTGGCAACTCGTCCAAGGCCACGTACTACCGAAACCCCCAATATAAGCTG
GTCGCGAGCAGGTCCACCCCTGTCTCTATTCTACTATCTACCGACAACCGCGAGGTTCAAGTGCACGTCGATGTT
GTCTGGGCCCGCGGGCAGCGGGTTACAAGTATACGTGTCAAGGATCTCGTCTTCTCTTCAGGAGAGTATCATCGC
GGATGCGCCATGGCAACCATTCCCATGTTGGAATCTGGTACTTACACTCTGGTCTGCTCGACGTTTGACGCCGGC
CAAACGGCCGCTTTTGCCATACAAGTGTCGTCCATGTCGCCTCTGTCCCTGGACCCTCTTCCAGCTGAAGCGGCA
GGGAGATTGCGAACAACCCTGGGGACGTTCAACCCGGTGAGGGGCGAGGGCGGTGCTCGTGCTTCCTTGACGGCG
TCGTGGCTCACACGTGCGAGCATCTCCGTTTACAATGTGCAGCTGCCGGACGCTGCTAACGGAGCGCGGCACGCC
TCGTCTGTTCTACTACGAGTCTCAGTCGTGCAAGGCTGGGGCTCGGAGCAGGTTACGGTTGCAATTTCCGGTGAT
GGACAGTTTCGGGAACCAACGACAGATCTACGCACCGGCGATTTCGACATGGAGCCTGACAAGGTGCAGAGAGAG
GATAACGAGGTCAAGTGA
Transcript >Ophun1|4717
ATGGAGAGGAGGGCTCAGGCCGCTGAGGCTTCATTCGCTCGATCAAGCGGCAGAATCGCCCTTGAGCATGCGATT
CGGGCCGCGGAGCTTTACATGAAAGCCGCTGGCGAAACTTCAGACAAGGCACAGGCCACTCATCTGAGGAGCAAA
TGCCAGGAACTGATTGCTCTCGCGGAAAAGCTGAAGAAGAGGCAAGAGACGGCAACGACGCCACCCCAGTCAGAC
ATTCTGCTTGGCGTCCTGCGCCTTCATGGGAACGATTTTCCGCCGTGGCATGGTGATCCCGACGATGACGAATTC
GAGCTCAACCCTGGCTCGCAATACTATACAGATGAAGCACCGTTCACGCTATCGGCAACCCAGGCGCAAAACTTC
AAAGCATGGACCAGACCGGCGGAACTCTTTGGACTTGCGCCTGACCGCGACAAAAGTCTAGATGAAGACATCTTG
ATGCAGGTTCATGAGCACTGCGATCTAGTCCAGGACATAACAACAGACTGCTCTGTTGTCGCCAGTCTTTCTGCA
GCTGCAAAGGTCATGGTCGGGCCCCATGCGGTATGCACTGGCCGAATCTCTGCGGAGGAAGAGCGACTCATGGGA
CTCATCGGCGAGCATGACTACGCAGTGGAGGACCTTCACTCGCCTGACGGCAATACACGCAAGCTACTCATCAAG
AATCCTTGGCGCGACGCGCCCTTGATCGTAGGAACTGGAGGTCCAGACACTGGTCGCGACAACACGACTTGGATA
ACGCTGGAGGACGTGGCTCAACACTTCGAGACCATGTACCTGAATTGGAATCCTAGCTTATTCAACTGTCGGCAG
GATCACCATCTGACGTGGGAGTTGCCTCCCAACTATCTTGCGACCTCATTGGTCAAAAATCCCCAATACTCTCTG
TCGTCCTCTACCGGCGGCTCCATATGGATTCTGGTTGGTCGTCACTTCGTGGACGCTGAGCTCGAAATCGCTCGC
AGCAGACGTGGCTCTCTGGCCGCAGTCGCGCGACAACTGGGATTCATGAGCATTCTGGTCTTCGACAACGGTGGC
AAGAGAGCTCATGTAAGTGGGCCGGAAATCTATCGCGGTCCCTACGTCGACTCCCCGCAGACACTCGCGCGTCTT
GAGGCAAGTCCCGGAAAGAGGTACACAATAGTCATCGATCAGCATGAGCTGCCTCTGCCCAGCTATTCTTTGACC
TTGACACTTTTCTCCAACTCGCCACTGGAAGTCAAGCTAGCAGAAGAGAGAATGCACCACAACTTGGAGCGCACA
GGGGCCTGGAGCAGACGTAACGCTGGTGGCAACTCGTCCAAGGCCACGTACTACCGAAACCCCCAATATAAGCTG
GTCGCGAGCAGGTCCACCCCTGTCTCTATTCTACTATCTACCGACAACCGCGAGGTTCAAGTGCACGTCGATGTT
GTCTGGGCCCGCGGGCAGCGGGTTACAAGTATACGTGTCAAGGATCTCGTCTTCTCTTCAGGAGAGTATCATCGC
GGATGCGCCATGGCAACCATTCCCATGTTGGAATCTGGTACTTACACTCTGGTCTGCTCGACGTTTGACGCCGGC
CAAACGGCCGCTTTTGCCATACAAGTGTCGTCCATGTCGCCTCTGTCCCTGGACCCTCTTCCAGCTGAAGCGGCA
GGGAGATTGCGAACAACCCTGGGGACGTTCAACCCGGTGAGGGGCGAGGGCGGTGCTCGTGCTTCCTTGACGGCG
TCGTGGCTCACACGTGCGAGCATCTCCGTTTACAATGTGCAGCTGCCGGACGCTGCTAACGGAGCGCGGCACGCC
TCGTCTGTTCTACTACGAGTCTCAGTCGTGCAAGGCTGGGGCTCGGAGCAGGTTACGGTTGCAATTTCCGGTGAT
GGACAGTTTCGGGAACCAACGACAGATCTACGCACCGGCGATTTCGACATGGAGCCTGACAAGGTGCAGAGAGAG
GATAACGAGGTCAAGTGA
Gene >Ophun1|4717
ATGGAGAGGAGGGCTCAGGTTTGCAGCCCATCGCGCGCAGCGGTCAACAAAGTAGACCATCTGCTGACCCGACTG
CCGATTAGGCCGCTGAGGCTTCATTCGCTCGATCAAGCGGCAGAATCGCCCTTGAGCATGCGATTCGGGCCGCGG
AGCTTTACATGAAAGCCGCTGGCGAAACTTCAGACAAGGCACAGGCCACTCATCTGAGGAGCAAATGCCAGGAAC
TGATTGCTCTCGCGGAAAAGCTGAAGAAGAGGCAAGAGACGGCAACGACGCCACCCCAGTCAGACATTCTGCTTG
GCGTCCTGCGCCTTCATGGGAACGATTTTCCGCCGTGGCATGGTGATCCCGACGATGACGAATTCGAGCTCAACC
CTGGCTCGCAATACTATACGTAAGTTCGAACAGTTTTATCGACCCACGCCCCGTCTCTCTGATTACAATTGCTTG
AAAGAGATGAAGCACCGTTCACGCTATCGGCAACCCAGGCGCAAAACTTCAAAGCATGGACCAGACCGGCGGAAC
TCTTTGGACTTGCGCCTGACCGCGACAAAAGTCTAGATGAAGACATCTTGATGCAGGTTCATGAGCACTGCGATC
TAGTCCAGGACATAACAACAGACTGCTCTGTTGTCGCCAGTCTTTCTGCAGCTGCAAAGGTCATGGTCGGGCCCC
ATGCGGTATGTGAATACGATGGCATGGACCATGTGCATTGGCCGGCATTGGCTGGCAAACACAATGGAAGTATTA
ACCTGGTTTCCTTCTTAGGTTCTTTCCACCATCTTATATCCTTTTGATCACGTTAAAGGTCGTCCAAAGCTGTCC
CGCTCAGGAAAATATGTGTTGCGCATGAACTTTAATGGCTGCTCAAGGCGAGTTGTGGTAGACGATAGGCTTCCT
GCCTCCTGTACTGATCGGACCCTTTTTGTGGTGGATCGTCGGAACCCTCAACTGCTCTGGCCTGCTCTACTAGAG
AAGGCGTATCTCAAAGTCAGAGGCGGCTATGACTTTCCGGGGAGCAACTCTGGGACTGACTTGTGGGTTCTGACC
GGGTGGATACCTGAGCAACTTTTCCTTCAGGTGTAGGTCAACCTCTTCTCCAGCGTAGCTCGCATGTTGACTCAT
TCCAAAGCGAGGACCTAGATTACGACGAGACTTGGGCGAGAGTCAAGGCAGCTCACGAGTCTTGCGATGTCGTCG
TAACTTTAGGCACTGGCCGAATCTCTGCGGAGGAAGAGCGACTCATGGGACTCATCGGCGAGCATGACTACGCAG
TGGAGGACCTTCACTCGCCTGACGGCAATACACGCAAGCTACTCATCAAGAATCCTTGGCGCGACGCGCCCTTGA
TCGTAGGAACTGGAGGTCCAGACACTGGTCGCGACAAGTGAGCCGCCTTCATAGCCTCACACACGGCAGCTGCTG
ACCCAGAGATAGCACGACTTGGATAACGCTGGAGGACGTGGCTCAACACTTCGAGACCATGTACCTGAATTGGAA
TCCTAGCTTATTCAACTGTCGGCAGGATCACCATCTGACGTGGGAGTTGCCTCCCAACTATCTTGCGACCTCATT
GGTCAAAAATCCCCAATACTCTCTGTCGTCCTCTACCGGCGGCTCCATATGGATTCTGGTTGGTCGTCACTTCGT
GGACGCTGAGCTCGAAATCGCTCGCAGCAGACGTGGCTCTCTGGCCGCAGTCGCGCGACAACTGGGATTCATGAG
CATTCTGGTCTTCGACAACGGTGGCAAGAGAGCTCATGTAAGTGGGCCGGAAATCTATCGCGGTCCCTACGTCGA
CTCCCCGCAGACACTCGCGCGTCTTGAGGCAAGTCCCGGAAAGAGGTACACAATAGTCATCGATCAGCATGAGCT
GCCTCTGCCCAGCTATTCTTTGACCTTGACACTTTTCTCCAACTCGCCACTGGAAGTCAAGCTAGCAGAAGAGAG
AATGCACCACAACTTGGAGCGCACAGGGGCCTGGAGCAGACGTAACGCTGGTGGCAACTCGTCCAAGGCCACGTA
CTACCGAAACCCCCAATATAAGCTGGTCGCGAGCAGGTCCACCCCTGTCTCTATTCTACTATCTACCGACAACCG
CGAGGTTCAAGTGCACGTCGATGTTGTCTGGGCCCGCGGGCAGCGGGTTACAAGTATACGTGTCAAGGATCTCGT
CTTCTCTTCAGGAGAGTATCATCGCGGATGCGCCATGGCAACCATTCCCATGTTGGAATCTGGTACTTACACTCT
GGTCTGCTCGACGTTTGACGCCGGCCAAACGGCCGCTTTTGCCATACAAGTGTCGTCCATGTCGCCTCTGTCCCT
GGACCCTCTTCCAGCTGAAGCGGCAGGGAGATTGCGAACAACCCTGGGGACGTTCAACCCGGTGAGGGGCGAGGG
CGGTGCTCGTGCTTCCTTGACGGCGTCGTGGCTCACACGTGCGAGCATCTCCGTTTACAATGTGCAGCTGCCGGA
CGCTGCTAACGGAGCGCGGCACGCCTCGTCTGTTCTACTACGAGTCTCAGTCGTGCAAGGCTGGGGCTCGGAGCA
GGTTACGGTTGCAATTTCCGGTGATGGACAGTTTCGGGAACCAACGACAGATCTACGCACCGGCGATTTCGACAT
GGAGCCTGACAAGGTGCAGAGAGAGGGTATGTGGCTCGTGATTGAATGCTTAGGGTCGCACCAAGCTTTGTGGGC
CGTCGATGGCGAGATCCTCAGTGATTCGCCAATCCAAGTTGGCATATGGCAGTCTTTGTAACCGCAGTAGATAAC
GAGGTCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail