Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4716
Gene name
LocationContig_440:2577..3740
Strand-
Gene length (bp)1163
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04059 RRM_2 RNA recognition motif 2 1.5E-23 30 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 16 94 7.0E-22
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 2 90 2.0E-18
sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 18 97 2.0E-18
sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=2 SV=1 2 83 1.0E-17
sp|Q8VWF5|AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana GN=ML5 PE=1 SV=1 2 83 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 16 94 7.0E-22
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 2 90 2.0E-18
sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 18 97 2.0E-18
sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=2 SV=1 2 83 1.0E-17
sp|Q8VWF5|AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana GN=ML5 PE=1 SV=1 2 83 1.0E-17
sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 17 90 2.0E-17
sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 18 83 4.0E-17
sp|Q6EQX3|OML5_ORYSJ Protein MEI2-like 5 OS=Oryza sativa subsp. japonica GN=ML5 PE=2 SV=1 17 104 6.0E-17
sp|Q64M78|OML4_ORYSJ Protein MEI2-like 4 OS=Oryza sativa subsp. japonica GN=ML4 PE=2 SV=1 18 83 6.0E-17
sp|Q9SJG8|AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana GN=ML2 PE=2 SV=2 4 98 1.0E-16
sp|O65001|TE1_MAIZE Protein terminal ear1 OS=Zea mays GN=TE1 PE=2 SV=1 27 81 5.0E-12
sp|A2WY46|EAR1_ORYSI Protein terminal ear1 homolog OS=Oryza sativa subsp. indica GN=PLA2 PE=2 SV=1 28 81 3.0E-11
sp|Q0JGS5|EAR1_ORYSJ Protein terminal ear1 homolog OS=Oryza sativa subsp. japonica GN=PLA2 PE=2 SV=1 28 81 3.0E-11
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7951
Ophiocordyceps australis map64 (Brazil) OphauB2|4669
Ophiocordyceps camponoti-floridani Ophcf2|04256
Ophiocordyceps camponoti-rufipedis Ophun1|4716 (this protein)
Ophiocordyceps kimflemingae Ophio5|8617
Ophiocordyceps subramaniannii Hirsu2|2180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4716
MRISRSSHHSVTGHHNHVDINRIRDGIDVRTTIMLRNIPNKVDQSMLKRIIDESSWGKYDFMYLRIDFANDCNVG
YAFINFVDMFVISAYTRTKKSKLTIEQFVDARGNQRCFTSLATVLCLISQVRKNHSQTLTISLFTPNAGQHFRDE
QRRRRSQYDRGTRLAALEEYDYEAAMQHLYGTTK*
Coding >Ophun1|4716
ATGCGCATCAGTCGATCGTCACACCACAGTGTAACGGGTCATCACAACCACGTTGACATCAACCGAATTCGTGAC
GGCATTGATGTTCGAACTACGATAATGCTGCGGAATATACCCAACAAGGTCGACCAGTCAATGCTTAAGCGAATT
ATTGATGAGTCCAGCTGGGGCAAGTACGACTTCATGTACCTAAGGATTGATTTCGCCAATGACTGCAACGTTGGC
TACGCTTTCATCAACTTCGTCGACATGTTTGTCATCTCCGCCTACACTCGGACTAAGAAATCCAAACTGACAATC
GAGCAGTTCGTCGATGCGCGCGGCAATCAGCGTTGCTTTACTTCACTTGCAACGGTCCTATGCCTGATCTCGCAG
GTCAGGAAGAACCATTCCCAGACCCTGACAATCAGCCTATTTACTCCCAATGCCGGGCAGCACTTTAGAGACGAG
CAACGCCGTAGACGATCGCAATATGATCGGGGGACTCGGCTGGCCGCTCTCGAAGAGTACGACTATGAGGCGGCC
ATGCAGCACCTCTACGGCACAACAAAATGA
Transcript >Ophun1|4716
ATGCGCATCAGTCGATCGTCACACCACAGTGTAACGGGTCATCACAACCACGTTGACATCAACCGAATTCGTGAC
GGCATTGATGTTCGAACTACGATAATGCTGCGGAATATACCCAACAAGGTCGACCAGTCAATGCTTAAGCGAATT
ATTGATGAGTCCAGCTGGGGCAAGTACGACTTCATGTACCTAAGGATTGATTTCGCCAATGACTGCAACGTTGGC
TACGCTTTCATCAACTTCGTCGACATGTTTGTCATCTCCGCCTACACTCGGACTAAGAAATCCAAACTGACAATC
GAGCAGTTCGTCGATGCGCGCGGCAATCAGCGTTGCTTTACTTCACTTGCAACGGTCCTATGCCTGATCTCGCAG
GTCAGGAAGAACCATTCCCAGACCCTGACAATCAGCCTATTTACTCCCAATGCCGGGCAGCACTTTAGAGACGAG
CAACGCCGTAGACGATCGCAATATGATCGGGGGACTCGGCTGGCCGCTCTCGAAGAGTACGACTATGAGGCGGCC
ATGCAGCACCTCTACGGCACAACAAAATGA
Gene >Ophun1|4716
ATGCGCATCAGTCGATCGTCACACCACAGTGTAACGGGTCATCACAACCACGTTGACATCAACCGAATTCGTGAC
GGCATTGATGTTCGAACTACGGTACGTCTCACAGCTTTCACATCATCATGGATCTGACAAGTATCAGATAATGCT
GCGGAATATACCCAACAAGGTCGACCAGTCAATGCTTAAGCGAATTATTGATGAGTCCAGCTGGGGCAAGTACGA
CTTCATGTACCTAAGGATTGATTTCGCCAATGACTGCAAGTGAGTCTTGAAGCTTACGACGGTTGCTCAAACCTG
ATCACGGACTGATATTTGATGCTTCGCGGCACCTAAACAGCGTTGGCTACGCTTTCATCAACTTCGTCGACGTGA
GTAAACTGCCCTTGGGCCTTCTCCAAAACACCTAGCAACTTGTTCTGACTGCACGTTAAGCCGCTAGATATCATA
GATGTTTGTCATCTCCGCCTACACTCGGACTAAGAAATCCAAACTGACAATCGAGCAGTTCGTCGATGCGCGCGG
CAATCAGCGTTGGTAAGTGATGCTTCATCGAACTAAATCGGGGGACTGTGCACTAATTGGTGCTCAGGAACTGCT
TCAAGAGTGATAAAGTTGCAGAGATATCCTATGCTAGTGAGTCTTACGTTCACGTCTTGCCGGGGAGGGGGGGCT
AAGACCGCTTTCAGCAATCCAGGGTAAAGATTGTTTGGTGCAAAAATTCCGAAATAGCTCAGTCATGCTCGAGGC
ACCTCATTATCGACCCAAGGTATGCCATGTTCCTGCACCTCCTTCGCCATGCGTGATGTACCAAGATGTGTGCCT
TAGTAGGCCGTGCTAAGTTCGTGCAGCTTTACTTCACTTGCAACGGTCCTATGCCTGATCTCGCAGGTCAGGAAG
AACCATTCCCAGACCCTGACAATCAGTCGAAAATGAAGAGAAGCTGCGAGAATGCTGAGCACGTTGGCAAGTTGA
ATGTTCAGCTAAATCTCTGACCATTTGCTTATCCTTTTATAGGCCTATTTACTCCCAATGCCGGGCAGCACTTTA
GAGACGAGCAACGCCGTAGACGATCGCAATATGATCGGGGGACTCGGCTGGCCGCTCTCGAAGAGTACGACTATG
AGGCGGCCATGCAGCACCTCTACGGCACAACAAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail