Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4714
Gene name
LocationContig_44:46597..48531
Strand+
Gene length (bp)1934
Transcript length (bp)1746
Coding sequence length (bp)1746
Protein length (aa) 582

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.8E-25 62 432
PF00083 Sugar_tr Sugar (and other) transporter 4.5E-19 83 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 16 523 2.0E-68
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 35 290 2.0E-17
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 35 316 2.0E-17
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 35 290 2.0E-17
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 35 290 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 16 523 2.0E-68
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 35 290 2.0E-17
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 35 316 2.0E-17
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 35 290 2.0E-17
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 35 290 3.0E-17
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 35 290 3.0E-17
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 35 290 3.0E-17
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 40 524 8.0E-16
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 10 290 1.0E-15
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 35 290 2.0E-15
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 10 290 5.0E-15
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 7 290 2.0E-14
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 39 319 3.0E-14
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 44 290 7.0E-14
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 39 319 2.0E-13
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 39 319 2.0E-13
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 39 319 3.0E-13
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 44 290 5.0E-13
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 35 291 7.0E-13
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 39 319 5.0E-11
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 39 319 1.0E-10
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 10 398 5.0E-10
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 41 563 9.0E-10
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 59 204 1.0E-09
sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter PcaK OS=Pseudomonas putida GN=pcaK PE=1 SV=1 40 180 1.0E-08
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 51 578 7.0E-08
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 44 243 2.0E-06
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 44 180 2.0E-06
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 51 299 3.0E-06
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 32 292 3.0E-06
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 102 581 7.0E-06
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 51 298 7.0E-06
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 42 269 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 92 114 22
3 121 143 22
4 147 169 22
5 182 204 22
6 239 261 22
7 372 394 22
8 414 436 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4714
MADSPTRAKPDAAHLESRDTTMDLSGLQHLSVYEQKCALVSRELDHQGMGRYQWYIWFLCGFGYFLDLLWAQAFA
LVLSPLQQELGFSNNQSGNISMSFNVGLTTGAFFWGFMSDIIGRRWAFNLTCLLSSVFGLCLGAANNYNTFLVLT
AFIGFGVGGNIPVDGAIFLEFAPQRRQYMLACLSIFQPAGVIACSALAFAFIPTHSCSPNFSEPNPLPSCYNVST
PDAACCSREANMGWRYLLYTLGALTLAVFILRTLIFRCRETPRFLIYRGQDARAIRTLEYVAKVNKQKCQISLQL
LDSLQNEYDLKKARSQMSPPSPMSPLSPTSPLSPLSPSENRSEFIQKSKKQKLGQELGRFKLLFATRRMTSLTIL
TWLTYILDFGGFNIAGFYLPRILALKNGQESISLTHTYASYIYCYVPGILAVLLGAYASQIPALGQKWTMVASSG
LMATSIFLLSRVNSAATSEGLFALEYFFQSTFNAVLYGWTPQAFPAPIRGTACGVASFWGRLFGIVSPLIAQHLY
GQASGNRGNVDGVLYLAGGVTMGCVLTTALLPRTAAEEEEMKTRDPSYEPIASPRV*
Coding >Ophun1|4714
ATGGCCGATTCTCCCACCCGGGCCAAGCCCGATGCTGCCCATCTCGAGAGCAGAGACACCACCATGGATCTGTCT
GGCCTCCAGCATCTGTCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAGCTCGATCATCAGGGCATGGGT
CGCTACCAGTGGTACATCTGGTTCCTCTGCGGCTTCGGCTACTTCCTCGATCTGCTCTGGGCCCAGGCCTTTGCC
CTGGTCTTGAGCCCGCTGCAGCAGGAGCTGGGCTTCTCCAACAACCAGTCGGGCAACATCTCGATGAGCTTCAAT
GTCGGTCTGACGACGGGCGCGTTTTTCTGGGGCTTCATGTCCGACATTATCGGACGCCGATGGGCCTTTAACCTC
ACGTGTCTCCTCTCCTCCGTCTTCGGCCTCTGCCTCGGCGCTGCCAACAACTACAACACGTTTCTCGTCCTGACG
GCCTTTATCGGCTTCGGCGTGGGCGGCAACATCCCCGTCGATGGCGCCATCTTCCTCGAGTTTGCTCCCCAGCGG
AGACAATACATGCTCGCCTGCCTCTCCATCTTCCAGCCCGCCGGAGTCATCGCCTGCAGCGCCCTCGCCTTCGCC
TTCATTCCCACCCATTCCTGCTCCCCCAACTTCTCGGAGCCGAACCCGCTACCCTCGTGCTACAACGTGTCGACC
CCCGATGCTGCCTGCTGCTCGCGCGAGGCCAACATGGGTTGGCGTTACCTCCTCTATACTCTGGGTGCCTTGACG
CTGGCCGTCTTCATCCTGCGCACTCTCATCTTCCGCTGCCGGGAGACGCCCAGGTTCCTCATCTACCGCGGTCAG
GACGCCAGGGCCATCCGCACGCTCGAGTACGTGGCCAAGGTCAACAAGCAGAAATGCCAAATCTCGCTCCAGCTG
CTCGACTCGCTGCAGAACGAGTACGACCTGAAGAAGGCTCGCTCGCAGATGAGCCCGCCCAGCCCCATGAGCCCC
CTCAGCCCCACCAGCCCGCTGAGCCCGCTGAGCCCGTCGGAAAATCGGTCCGAGTTTATACAAAAGTCGAAAAAG
CAGAAGCTCGGCCAAGAACTGGGCAGGTTCAAGCTGCTGTTTGCCACGAGACGCATGACGAGCTTGACGATCCTT
ACCTGGTTGACGTACATTCTGGACTTTGGGGGCTTCAACATTGCCGGCTTCTATCTTCCCCGGATCTTGGCCCTC
AAAAACGGCCAAGAGTCCATCAGCCTCACCCACACGTACGCCTCGTACATATACTGCTACGTGCCGGGCATCCTC
GCCGTGCTGCTGGGCGCCTACGCAAGTCAAATCCCGGCCCTCGGCCAGAAGTGGACAATGGTCGCCTCGTCCGGC
CTGATGGCGACGTCCATCTTTCTGCTCTCCCGCGTCAACTCGGCCGCCACGAGCGAGGGTCTCTTTGCACTCGAG
TACTTCTTCCAGTCGACCTTCAACGCCGTCCTCTACGGATGGACACCCCAGGCGTTCCCTGCGCCCATCAGGGGC
ACGGCCTGCGGCGTCGCCAGCTTCTGGGGGCGGCTGTTTGGCATCGTCAGTCCGCTGATAGCCCAGCACCTCTAC
GGGCAGGCGTCCGGCAATCGCGGCAACGTGGACGGCGTCCTCTACCTGGCTGGAGGCGTGACGATGGGCTGCGTC
TTGACGACGGCGCTGCTGCCGAGGACGGCGGCCGAGGAGGAGGAGATGAAGACGAGAGATCCGAGTTACGAGCCG
ATAGCCAGTCCGCGGGTATGA
Transcript >Ophun1|4714
ATGGCCGATTCTCCCACCCGGGCCAAGCCCGATGCTGCCCATCTCGAGAGCAGAGACACCACCATGGATCTGTCT
GGCCTCCAGCATCTGTCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAGCTCGATCATCAGGGCATGGGT
CGCTACCAGTGGTACATCTGGTTCCTCTGCGGCTTCGGCTACTTCCTCGATCTGCTCTGGGCCCAGGCCTTTGCC
CTGGTCTTGAGCCCGCTGCAGCAGGAGCTGGGCTTCTCCAACAACCAGTCGGGCAACATCTCGATGAGCTTCAAT
GTCGGTCTGACGACGGGCGCGTTTTTCTGGGGCTTCATGTCCGACATTATCGGACGCCGATGGGCCTTTAACCTC
ACGTGTCTCCTCTCCTCCGTCTTCGGCCTCTGCCTCGGCGCTGCCAACAACTACAACACGTTTCTCGTCCTGACG
GCCTTTATCGGCTTCGGCGTGGGCGGCAACATCCCCGTCGATGGCGCCATCTTCCTCGAGTTTGCTCCCCAGCGG
AGACAATACATGCTCGCCTGCCTCTCCATCTTCCAGCCCGCCGGAGTCATCGCCTGCAGCGCCCTCGCCTTCGCC
TTCATTCCCACCCATTCCTGCTCCCCCAACTTCTCGGAGCCGAACCCGCTACCCTCGTGCTACAACGTGTCGACC
CCCGATGCTGCCTGCTGCTCGCGCGAGGCCAACATGGGTTGGCGTTACCTCCTCTATACTCTGGGTGCCTTGACG
CTGGCCGTCTTCATCCTGCGCACTCTCATCTTCCGCTGCCGGGAGACGCCCAGGTTCCTCATCTACCGCGGTCAG
GACGCCAGGGCCATCCGCACGCTCGAGTACGTGGCCAAGGTCAACAAGCAGAAATGCCAAATCTCGCTCCAGCTG
CTCGACTCGCTGCAGAACGAGTACGACCTGAAGAAGGCTCGCTCGCAGATGAGCCCGCCCAGCCCCATGAGCCCC
CTCAGCCCCACCAGCCCGCTGAGCCCGCTGAGCCCGTCGGAAAATCGGTCCGAGTTTATACAAAAGTCGAAAAAG
CAGAAGCTCGGCCAAGAACTGGGCAGGTTCAAGCTGCTGTTTGCCACGAGACGCATGACGAGCTTGACGATCCTT
ACCTGGTTGACGTACATTCTGGACTTTGGGGGCTTCAACATTGCCGGCTTCTATCTTCCCCGGATCTTGGCCCTC
AAAAACGGCCAAGAGTCCATCAGCCTCACCCACACGTACGCCTCGTACATATACTGCTACGTGCCGGGCATCCTC
GCCGTGCTGCTGGGCGCCTACGCAAGTCAAATCCCGGCCCTCGGCCAGAAGTGGACAATGGTCGCCTCGTCCGGC
CTGATGGCGACGTCCATCTTTCTGCTCTCCCGCGTCAACTCGGCCGCCACGAGCGAGGGTCTCTTTGCACTCGAG
TACTTCTTCCAGTCGACCTTCAACGCCGTCCTCTACGGATGGACACCCCAGGCGTTCCCTGCGCCCATCAGGGGC
ACGGCCTGCGGCGTCGCCAGCTTCTGGGGGCGGCTGTTTGGCATCGTCAGTCCGCTGATAGCCCAGCACCTCTAC
GGGCAGGCGTCCGGCAATCGCGGCAACGTGGACGGCGTCCTCTACCTGGCTGGAGGCGTGACGATGGGCTGCGTC
TTGACGACGGCGCTGCTGCCGAGGACGGCGGCCGAGGAGGAGGAGATGAAGACGAGAGATCCGAGTTACGAGCCG
ATAGCCAGTCCGCGGGTATGA
Gene >Ophun1|4714
ATGGCCGATTCTCCCACCCGGGCCAAGCCCGATGCTGCCCATCTCGAGAGCAGAGACACCACCATGGATCTGTCT
GGCCTCCAGCATCTGTCCGTCTACGAGCAAAAGTGCGCCCTCGTCAGCCGCGAGCTCGATCATCAGGGCATGGGT
CGCTACCAGTGGTACATCTGGTTCCTCTGCGGCTTCGGCTACTTCCTCGATCTGCTCTGGGCCCAGGCCTTTGCC
CTGGTCTTGAGCCCGCTGCAGCAGGAGCTGGGCTTCTCCAACAACCAGTCGGGCAACATCTCGATGAGCTTCAAT
GTCGGTCTGACGACGGGCGCGTTTTTCTGGGGCTTCATGTCCGACATTATCGGTACTTTCTTTTACCTTGTCTCT
CGGCTCCCTCCCGCTGACCCTGGCCCTCATCAGGACGCCGATGGGCCTTTAACCTCACGTGTCTCCTCTCCTCCG
TCTTCGGCCTCTGCCTCGGCGCTGCCAACAACTACAACACGTTTCTCGTCCTGACGGCCTTTATCGGCTTCGGCG
TGGGCGGCAACATCCCCGTCGATGGCGCCATCTTCCTCGAGTTTGCTCCCCAGGTTGGTCTTCTTTTCTCTTCGA
CTCTTCCCATCCAGGGAGGCCAAAAGCATCGAGCTAACCCGATCCCCCTGCAGCGGAGACAATACATGCTCGCCT
GCCTCTCCATCTTCCAGCCCGCCGGAGTCATCGCCTGCAGCGCCCTCGCCTTCGCCTTCATTCCCACCCATTCCT
GCTCCCCCAACTTCTCGGAGCCGAACCCGCTACCCTCGTGCTACAACGTGTCGACCCCCGATGCTGCCTGCTGCT
CGCGCGAGGCCAACATGGGTTGGCGTTACCTCCTCTATACTCTGGGTGCCTTGACGCTGGCCGTCTTCATCCTGC
GCACTCTCATCTTCCGCTGCCGGGAGACGCCCAGGTTCCTCATCTACCGCGGTCAGGACGCCAGGGCCATCCGCA
CGCTCGAGTACGTGGCCAAGGTCAACAAGCAGAAATGCCAAATCTCGCTCCAGCTGCTCGACTCGCTGCAGAACG
AGTACGACCTGAAGAAGGCTCGCTCGCAGATGAGCCCGCCCAGCCCCATGAGCCCCCTCAGCCCCACCAGCCCGC
TGAGCCCGCTGAGCCCGTCGGAAAATCGGTCCGAGTTTATACAAAAGTCGAAAAAGCAGAAGCTCGGCCAAGAAC
TGGGCAGGTTCAAGCTGCTGTTTGCCACGAGACGCATGACGAGCTTGACGATCCTTACCTGGTTGACGTACATTC
TGGACTTTGGGGGCTTCAACATTGCCGGTATGCATATATCACCATGTCCGCTGGAGACTTAGTCCTCTAACAGTG
CCTATGCAGGCTTCTATCTTCCCCGGATCTTGGCCCTCAAAAACGGCCAAGAGTCCATCAGCCTCACCCACACGT
ACGCCTCGTACATATACTGCTACGTGCCGGGCATCCTCGCCGTGCTGCTGGGCGCCTACGCAAGTCAAATCCCGG
CCCTCGGCCAGAAGTGGACAATGGTCGCCTCGTCCGGCCTGATGGCGACGTCCATCTTTCTGCTCTCCCGCGTCA
ACTCGGCCGCCACGAGCGAGGGTCTCTTTGCACTCGAGTACTTCTTCCAGTCGACCTTCAACGCCGTCCTCTACG
GATGGACACCCCAGGCGTTCCCTGCGCCCATCAGGGGCACGGCCTGCGGCGTCGCCAGCTTCTGGGGGCGGCTGT
TTGGCATCGTCAGTCCGCTGATAGCCCAGCACCTCTACGGGCAGGCGTCCGGCAATCGCGGCAACGTGGACGGCG
TCCTCTACCTGGCTGGAGGCGTGACGATGGGCTGCGTCTTGACGACGGCGCTGCTGCCGAGGACGGCGGCCGAGG
AGGAGGAGATGAAGACGAGAGATCCGAGTTACGAGCCGATAGCCAGTCCGCGGGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail