Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|471
Gene name
LocationContig_113:29075..29976
Strand-
Gene length (bp)901
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17119 MMU163 Mitochondrial protein up-regulated during meiosis 3.8E-51 64 191
PF17119 MMU163 Mitochondrial protein up-regulated during meiosis 4.8E-17 208 260

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3358
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1615
Ophiocordyceps australis map64 (Brazil) OphauB2|6744
Ophiocordyceps camponoti-floridani Ophcf2|06729
Ophiocordyceps camponoti-rufipedis Ophun1|471 (this protein)
Ophiocordyceps kimflemingae Ophio5|901
Ophiocordyceps subramaniannii Hirsu2|6245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|471
MAASLPKATRCPRTARQLATTLVQARASAPTPLLLPPRLPAATSAPALVGLRFKATTLHHQEVKPSAEKEPDPNK
VRLGATLRVLQDRLPTLLQSPLPQHLLAPNISLQLFPTTHPHLPTVSGRVAYNAALWTSPIAWNRVPIIGNVKLD
ILSSRLTKDRLSLVSRRPSAIPEQLVVRWCEKTRRDQDDEGAVAARRFLWPIGRGVDPNKAFSGLFIFDFDVQGR
ILTHTIEQAQDGGDWEAGVGAKFIGLTDWLLGEMSKPRDDSPVPVFEKLEKKTT*
Coding >Ophun1|471
ATGGCCGCGTCCCTGCCCAAGGCAACCAGGTGTCCCCGAACCGCCCGCCAGCTCGCCACGACGCTCGTCCAGGCC
CGCGCCTCGGCCCCGACGCCGCTTCTCCTCCCGCCCCGGCTGCCTGCGGCCACATCCGCTCCCGCTCTGGTTGGC
CTCCGCTTCAAGGCCACTACCCTTCATCATCAAGAGGTCAAGCCCAGCGCTGAGAAGGAGCCGGATCCGAACAAG
GTCCGGCTCGGGGCTACTCTTCGCGTGCTTCAAGACCGACTCCCCACGCTCCTCCAGTCCCCTCTCCCCCAACAT
CTACTCGCTCCCAACATCTCCCTCCAGCTCTTCCCGACAACACACCCTCACCTCCCCACCGTCTCAGGCCGGGTC
GCCTACAACGCCGCGCTGTGGACCTCGCCCATCGCCTGGAACCGCGTCCCCATCATCGGCAACGTCAAGCTCGAC
ATCCTGAGCAGCCGCCTGACCAAAGACCGTCTATCGCTGGTGTCGCGTCGGCCCAGCGCCATCCCCGAACAGCTG
GTGGTGCGCTGGTGCGAGAAGACTCGCCGTGATCAAGACGACGAGGGTGCCGTCGCCGCTCGTCGTTTTCTGTGG
CCAATCGGCCGCGGCGTCGATCCTAACAAGGCCTTTTCCGGCCTCTTCATCTTCGACTTTGACGTCCAGGGGAGG
ATCCTTACCCATACCATAGAGCAGGCTCAGGACGGTGGCGACTGGGAGGCCGGCGTTGGCGCAAAGTTCATCGGC
TTGACCGACTGGCTGCTGGGCGAGATGAGCAAACCCCGCGACGACAGCCCTGTTCCCGTCTTTGAGAAGCTCGAG
AAGAAGACTACCTAG
Transcript >Ophun1|471
ATGGCCGCGTCCCTGCCCAAGGCAACCAGGTGTCCCCGAACCGCCCGCCAGCTCGCCACGACGCTCGTCCAGGCC
CGCGCCTCGGCCCCGACGCCGCTTCTCCTCCCGCCCCGGCTGCCTGCGGCCACATCCGCTCCCGCTCTGGTTGGC
CTCCGCTTCAAGGCCACTACCCTTCATCATCAAGAGGTCAAGCCCAGCGCTGAGAAGGAGCCGGATCCGAACAAG
GTCCGGCTCGGGGCTACTCTTCGCGTGCTTCAAGACCGACTCCCCACGCTCCTCCAGTCCCCTCTCCCCCAACAT
CTACTCGCTCCCAACATCTCCCTCCAGCTCTTCCCGACAACACACCCTCACCTCCCCACCGTCTCAGGCCGGGTC
GCCTACAACGCCGCGCTGTGGACCTCGCCCATCGCCTGGAACCGCGTCCCCATCATCGGCAACGTCAAGCTCGAC
ATCCTGAGCAGCCGCCTGACCAAAGACCGTCTATCGCTGGTGTCGCGTCGGCCCAGCGCCATCCCCGAACAGCTG
GTGGTGCGCTGGTGCGAGAAGACTCGCCGTGATCAAGACGACGAGGGTGCCGTCGCCGCTCGTCGTTTTCTGTGG
CCAATCGGCCGCGGCGTCGATCCTAACAAGGCCTTTTCCGGCCTCTTCATCTTCGACTTTGACGTCCAGGGGAGG
ATCCTTACCCATACCATAGAGCAGGCTCAGGACGGTGGCGACTGGGAGGCCGGCGTTGGCGCAAAGTTCATCGGC
TTGACCGACTGGCTGCTGGGCGAGATGAGCAAACCCCGCGACGACAGCCCTGTTCCCGTCTTTGAGAAGCTCGAG
AAGAAGACTACCTAG
Gene >Ophun1|471
ATGGCCGCGTCCCTGCCCAAGGCAACCAGGTGTCCCCGAACCGCCCGCCAGCTCGCCACGACGCTCGTCCAGGCC
CGCGCCTCGGCCCCGACGCCGCTTCTCCTCCCGCCCCGGCTGCCTGCGGCCACATCCGCTCCCGCTCTGGTTGGC
CTCCGCTTCAAGGCCACTACCCTTCATCATCAAGAGGTCAAGCCCAGCGCTGAGAAGGAGCCGGATCCGAACAAG
GTCCGGCTCGGGGCTAGTGAGTTGGCTTCGCTGGTGAAGAAAGAAGAATGAACGAGGATGATAACAACGAGGCAA
AGCTCTTCGCGTGCTTCAAGACCGACTCCCCACGCTCCTCCAGTCCCCTCTCCCCCAACATCTACTCGCTCCCAA
CATCTCCCTCCAGCTCTTCCCGACAACACACCCTCACCTCCCCACCGTCTCAGGCCGGGTCGCCTACAACGCCGC
GCTGTGGACCTCGCCCATCGCCTGGAACCGCGTCCCCATCATCGGCAACGTCAAGCTCGACATCCTGAGCAGCCG
CCTGACCAAAGACCGTCTATCGCTGGTGTCGCGTCGGCCCAGCGCCATCCCCGAACAGCTGGTGGTGCGCTGGTG
CGAGAAGACTCGCCGTGATCAAGACGACGAGGGTGCCGTCGCCGCTCGTCGTTTTCTGTGGCCAATCGGCCGCGG
CGTCGATCCTAACAAGGCCTTTTCCGGCCTCTTCATCTTCGACTTTGACGTCCAGGGGAGGATCCTTACCCATAC
CATAGAGCAGGCTCAGGACGGTGGCGACTGGGAGGCCGGCGTTGGCGCAAAGTTCATCGGCTTGACCGACTGGCT
GCTGGGCGAGATGAGCAAACCCCGCGACGACAGCCCTGTTCCCGTCTTTGAGAAGCTCGAGAAGAAGACTACCTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail