Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4707
Gene name
LocationContig_44:33054..33765
Strand+
Gene length (bp)711
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10032 Pho88 Phosphate transport (Pho88) 1.3E-81 4 188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38264|PHO88_YEAST Inorganic phosphate transport protein PHO88 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO88 PE=1 SV=1 4 192 3.0E-57
sp|Q9HDZ8|YKP6_SCHPO Uncharacterized protein C589.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.06c PE=1 SV=1 4 163 2.0E-44
sp|O42940|PHO88_SCHPO Inorganic phosphate transport protein pho88 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pho88 PE=3 SV=2 5 182 2.0E-37

GO

GO Term Description Terminal node
GO:0045047 protein targeting to ER Yes
GO:0005783 endoplasmic reticulum Yes
GO:0071705 nitrogen compound transport No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0070972 protein localization to endoplasmic reticulum No
GO:0043229 intracellular organelle No
GO:0051649 establishment of localization in cell No
GO:0043226 organelle No
GO:0072599 establishment of protein localization to endoplasmic reticulum No
GO:0071702 organic substance transport No
GO:0033365 protein localization to organelle No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0072594 establishment of protein localization to organelle No
GO:0110165 cellular anatomical entity No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0006605 protein targeting No
GO:0045184 establishment of protein localization No
GO:0006886 intracellular protein transport No
GO:0008150 biological_process No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4707
MAGLNPQITNLIIILGMMQVSKRIPFDDPGVLNGVRGIYIASNVLIGLVYVYIYAQINKKKDMTTLKYVEPPPMG
STEEGKLITTTIHAYDLQQIRTALRGQLMGVAMMAFMHLYMKYTNPLLIQSIIPVKSALESNMVKIYLYGQPAIG
DLKRPFKQAQGFMSAMQNGQVQSDKKAVEAAEKASRGGAKEE*
Coding >Ophun1|4707
ATGGCGGGCCTCAACCCCCAGATCACCAACCTCATCATTATCCTCGGGATGATGCAGGTCTCGAAGCGGATTCCT
TTCGATGATCCTGGCGTTTTGAATGGTGTTCGGGGCATTTATATCGCTAGCAATGTCTTGATCGGTCTCGTCTAC
GTCTACATCTATGCGCAGATTAACAAGAAGAAGGACATGACGACGCTCAAGTACGTCGAGCCGCCGCCAATGGGC
TCTACCGAGGAGGGCAAGCTCATCACGACGACGATCCACGCCTACGACCTGCAGCAGATCCGCACCGCTCTCCGC
GGCCAACTCATGGGCGTCGCCATGATGGCCTTTATGCACCTGTACATGAAGTACACCAACCCGCTCCTCATCCAG
AGCATCATCCCCGTCAAGAGCGCCCTCGAGAGCAACATGGTCAAGATTTACCTCTACGGCCAGCCCGCCATCGGC
GACCTCAAGCGCCCGTTCAAGCAGGCCCAAGGCTTCATGAGCGCCATGCAGAACGGTCAGGTCCAGAGCGATAAG
AAGGCTGTCGAGGCGGCCGAGAAGGCTAGCCGTGGAGGCGCCAAGGAGGAGTAG
Transcript >Ophun1|4707
ATGGCGGGCCTCAACCCCCAGATCACCAACCTCATCATTATCCTCGGGATGATGCAGGTCTCGAAGCGGATTCCT
TTCGATGATCCTGGCGTTTTGAATGGTGTTCGGGGCATTTATATCGCTAGCAATGTCTTGATCGGTCTCGTCTAC
GTCTACATCTATGCGCAGATTAACAAGAAGAAGGACATGACGACGCTCAAGTACGTCGAGCCGCCGCCAATGGGC
TCTACCGAGGAGGGCAAGCTCATCACGACGACGATCCACGCCTACGACCTGCAGCAGATCCGCACCGCTCTCCGC
GGCCAACTCATGGGCGTCGCCATGATGGCCTTTATGCACCTGTACATGAAGTACACCAACCCGCTCCTCATCCAG
AGCATCATCCCCGTCAAGAGCGCCCTCGAGAGCAACATGGTCAAGATTTACCTCTACGGCCAGCCCGCCATCGGC
GACCTCAAGCGCCCGTTCAAGCAGGCCCAAGGCTTCATGAGCGCCATGCAGAACGGTCAGGTCCAGAGCGATAAG
AAGGCTGTCGAGGCGGCCGAGAAGGCTAGCCGTGGAGGCGCCAAGGAGGAGTAG
Gene >Ophun1|4707
ATGGCGGGCCTCAACCCCCAGATGTGAGCTGAAACCGCGTGGCTCGTGACTGCATCGTGGCCTCTCGCTGACGGT
ATCTGCAGCACCAACCTCATCATTATCCTCGGGATGATGCAGGTCTCGAAGCGGATTCCTTTCGATGATCCTGGC
GTTTTGAATGGTGTTCGGGGCATTTATATCGCTAGCAATGTCTTGATCGGTCTCGTCTACGTCTACATCTATGCG
CAGATTAACAAGAAGAAGGGTTCGTTGGCCCGCTCTCCTTGACTCTCACCGACTCTGCCTGCCATGACTGACTTT
CTTCTTAACCCCCCAGACATGACGACGCTCAAGTACGTCGAGCCGCCGCCAATGGGCTCTACCGAGGAGGGCAAG
CTCATCACGACGACGATCCACGCCTACGACCTGCAGCAGATCCGCACCGCTCTCCGCGGCCAACTCATGGGCGTC
GCCATGATGGCCTTTATGCACCTGTACATGAAGTACACCAACCCGCTCCTCATCCAGAGCATCATCCCCGTCAAG
AGCGCCCTCGAGAGCAACATGGTCAAGATTTACCTCTACGGCCAGCCCGCCATCGGCGACCTCAAGCGCCCGTTC
AAGCAGGCCCAAGGCTTCATGAGCGCCATGCAGAACGGTCAGGTCCAGAGCGATAAGAAGGCTGTCGAGGCGGCC
GAGAAGGCTAGCCGTGGAGGCGCCAAGGAGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail