Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4699
Gene name
LocationContig_44:15918..17278
Strand+
Gene length (bp)1360
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 6.2E-10 10 223

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUN9|ALD2_SPOSA Aldehyde reductase 2 OS=Sporidiobolus salmonicolor PE=1 SV=3 4 220 1.0E-40
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 7 221 2.0E-18
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 10 225 3.0E-17
sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 4 217 2.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup969
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|814
Ophiocordyceps australis map64 (Brazil) OphauB2|6339
Ophiocordyceps camponoti-floridani Ophcf2|03723
Ophiocordyceps camponoti-rufipedis Ophun1|4699 (this protein)
Ophiocordyceps kimflemingae Ophio5|3405
Ophiocordyceps subramaniannii Hirsu2|7679

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4699
MPAVPDGSLILVTGVNGYLGSHIAKQLLDHGFRVRGTVREALKADYMHALFDEKYGSDVFTTCIVEDMATTGAFD
DVTKAKETSVKRFVMTSSCVTATSTFDNGLLIDTASWNDPKDDIVWAPAPYHSDREAAVYIASKIASEKSCWRFM
EEQKPSFIFNAVLPGLVLGRIMDERQPASSAGLFKKIWEKDEELTTMVRTFPMQFFVDVTDLAVLHVAALREEDV
DIAIRTPSRWQQRVIVQEKKKQN*
Coding >Ophun1|4699
ATGCCCGCCGTTCCCGATGGTTCCCTCATCCTCGTTACAGGCGTCAACGGCTACCTCGGAAGCCACATCGCTAAG
CAACTCCTCGATCATGGCTTCCGCGTCCGCGGCACCGTTCGCGAAGCCCTCAAGGCTGACTACATGCACGCCTTG
TTTGACGAGAAGTACGGCAGCGATGTCTTTACAACCTGTATTGTCGAGGACATGGCTACCACCGGTGCCTTTGAC
GATGTTACAAAAGCCAAGGAAACGAGCGTGAAGCGCTTCGTTATGACGTCTTCTTGCGTGACCGCAACTTCGACC
TTTGATAACGGGCTCCTTATCGATACAGCGTCGTGGAACGACCCGAAGGATGACATCGTCTGGGCGCCAGCGCCT
TATCACTCGGACAGAGAGGCTGCGGTATATATAGCTAGCAAGATCGCTTCCGAAAAGAGCTGCTGGCGGTTTATG
GAAGAGCAGAAGCCATCATTCATCTTCAACGCCGTGCTTCCAGGCCTTGTCCTCGGCCGAATCATGGACGAACGG
CAGCCAGCGTCGTCGGCGGGGCTATTTAAAAAGATATGGGAAAAGGACGAGGAACTTACGACCATGGTTCGGACG
TTTCCGATGCAGTTCTTCGTTGACGTTACGGACTTGGCGGTTTTGCATGTTGCTGCTTTACGAGAGGAAGATGTG
GACATTGCGATTCGAACCCCAAGTCGCTGGCAGCAACGTGTCATCGTGCAGGAGAAAAAGAAACAGAACTAA
Transcript >Ophun1|4699
ATGCCCGCCGTTCCCGATGGTTCCCTCATCCTCGTTACAGGCGTCAACGGCTACCTCGGAAGCCACATCGCTAAG
CAACTCCTCGATCATGGCTTCCGCGTCCGCGGCACCGTTCGCGAAGCCCTCAAGGCTGACTACATGCACGCCTTG
TTTGACGAGAAGTACGGCAGCGATGTCTTTACAACCTGTATTGTCGAGGACATGGCTACCACCGGTGCCTTTGAC
GATGTTACAAAAGCCAAGGAAACGAGCGTGAAGCGCTTCGTTATGACGTCTTCTTGCGTGACCGCAACTTCGACC
TTTGATAACGGGCTCCTTATCGATACAGCGTCGTGGAACGACCCGAAGGATGACATCGTCTGGGCGCCAGCGCCT
TATCACTCGGACAGAGAGGCTGCGGTATATATAGCTAGCAAGATCGCTTCCGAAAAGAGCTGCTGGCGGTTTATG
GAAGAGCAGAAGCCATCATTCATCTTCAACGCCGTGCTTCCAGGCCTTGTCCTCGGCCGAATCATGGACGAACGG
CAGCCAGCGTCGTCGGCGGGGCTATTTAAAAAGATATGGGAAAAGGACGAGGAACTTACGACCATGGTTCGGACG
TTTCCGATGCAGTTCTTCGTTGACGTTACGGACTTGGCGGTTTTGCATGTTGCTGCTTTACGAGAGGAAGATGTG
GACATTGCGATTCGAACCCCAAGTCGCTGGCAGCAACGTGTCATCGTGCAGGAGAAAAAGAAACAGAACTAA
Gene >Ophun1|4699
ATGCCCGCCGTTCCCGATGGTTCCCTCATCCTCGTTACAGGCGTCAACGGCTACCTCGGAAGCCACATCGCTAAG
CAACTCCTCGATCATGGCTTCCGCGTCCGCGGCACCGTTCGCGAAGCCCTCAAGGCTGACTACATGCACGCCTTG
TTTGACGAGAAGTACGGCAGCGATGTCTTTACAACCTGTATTGTCGAGGACATGGCTACCACCGGTGCCTTTGAC
GATGTTACAAAAGGTGAGATGCTCTTCTTCAGCTTCCATACAATAAACCCTAAGACAAGATGCCTCGAGGCTGCT
CTGCTATCATGCATGTAGCAAGCCCTGTCTTTGGGAGCCCAGACCCGAACAAAATCATACCTGTGGTCCTAGCAG
GCACCCATAACGCGCTGGCCGCAGCAGCCAAGGAAACGAGCGTGAAGCGCTTCGTTATGACGTCTTCTTGCGTGA
CCGCAACTTCGACCTTTGATAACGGGCTCCTTATCGATACAGCGTCGTGGAACGACCCGAAGGATGACATCGTCT
GGGCGCCAGCGCCTTATCACTCGGACAGAGAGGCTGCGGTATATATAGCTAGCAAGATCGCTTCCGAAAAGAGCT
GCTGGCGGTTTATGGAAGAGCAGAAGCCATCATTCATCTTCAACGCCGTGCTTCCAGGCCTTGTCCTCGGCCGAA
TCATGGACGAACGGCAGCCAGCGTCGTCGGCGGGGCTATTTAAAAAGATATGGGAAAAGGACGAGGAACTTACGA
CCATGGTTCGGACGTTTCCGATGCAGTTCTTCGTTGACGTTACGGACTTGGCGGTTTTGCATGTTGCTGCTTTAC
GAGAGGAAGATGTGGTGAGCGAGAGACTGTTGGCTTTTGGGGAACGGGTTGATCCGAATGATGCGGTTGACGTGT
TTGTGAGGCTGCGGGATGGTCTGGACGGTTGTGCGGGAAGGAATTCGTCCAGGGAGATCTCTTACGTCAAGGCTG
GGGACTTGGAGAGATGTCGGGAGTTGCTGCGGAGGTATGGCCGGCCGGGATTCGCCAGCGTGGAATCCTCGATGA
AGGAGTTGGTTGAGTGTTGCCAGCGGTTTGAGCAGCAACGCTCGACATCTTGTTCTTAACTACGCGTGTGTCTGA
CTACATACATGTACTTAGTTATCCAAAGATCAAACTACTACTTTATATCACAACTCCTATAGCGAGGACGGTGAA
GAACGCGATAAGAAGAGTAGGAACAAGTCGGGCTGGCGAGGCGTATCACCTCCCTGCCACGCCGTATTTCTGACC
GACGAGCTCACAGGACATTGCGATTCGAACCCCAAGTCGCTGGCAGCAACGTGTCATCGTGCAGGAGAAAAAGAA
ACAGAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail