Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4693
Gene name
LocationContig_44:3222..4005
Strand+
Gene length (bp)783
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 5.1E-05 47 220

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T7|POF1L_SCHPO Putative nicotinamide mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.03 PE=3 SV=1 43 247 3.0E-31
sp|P25576|POF1_YEAST Nicotinamide mononucleotide adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POF1 PE=1 SV=1 14 223 6.0E-21

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6388
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4967
Ophiocordyceps australis map64 (Brazil) OphauB2|3938
Ophiocordyceps camponoti-floridani Ophcf2|03717
Ophiocordyceps camponoti-rufipedis Ophun1|4693 (this protein)
Ophiocordyceps kimflemingae Ophio5|3412

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4693
MSSPKRSLVDTFTRRLAAFHASALPLQILSTHPCPTSTLPSRLLVLDSSFNPPTMAHAQMAREALRKHDRLMLLL
SVANADKRVQPAGFASRLCLMDVLARKMAVDGAVVDLAVTTRPLFADKVAPVADSGVYEEVVFLVGFDTLVRILD
VKYYDDADKRDVVLASFFRRARLLVFIRPSDVWGSADEQRRFVEESAWRSRVDVRFGDETEGVSSSRVRELVRMP
GGAGRHEELARLVDEDILHWIESENLYCNHVQSSS*
Coding >Ophun1|4693
ATGTCCTCTCCAAAGAGGAGCCTCGTCGACACCTTTACCCGCCGCCTGGCCGCATTCCACGCCTCCGCCCTCCCC
CTTCAGATTCTCAGTACGCACCCATGTCCGACGTCGACGCTGCCCAGCCGCCTGCTGGTGCTGGACTCGAGCTTC
AACCCTCCGACGATGGCGCACGCGCAGATGGCACGCGAAGCACTGCGCAAACACGACCGGCTCATGCTGTTGCTC
TCTGTGGCGAATGCGGATAAGAGGGTCCAGCCTGCGGGGTTTGCGTCGCGGTTGTGCTTGATGGATGTGCTGGCG
AGGAAGATGGCGGTGGATGGGGCTGTGGTTGACTTGGCGGTTACGACGAGGCCTCTTTTCGCGGACAAGGTTGCT
CCTGTGGCGGATAGTGGCGTCTATGAGGAGGTTGTCTTCCTCGTTGGCTTCGACACGCTGGTGCGCATCCTTGAT
GTGAAATACTACGACGACGCGGATAAGAGGGACGTGGTGCTCGCCTCGTTCTTCCGTCGCGCTCGCCTGCTCGTC
TTCATCAGACCGTCTGACGTATGGGGCTCGGCGGATGAGCAGCGTCGGTTCGTAGAAGAGAGCGCGTGGAGGAGT
CGCGTTGATGTTCGTTTTGGTGATGAGACGGAGGGTGTTAGCAGCTCGCGGGTTAGGGAGCTGGTGCGTATGCCT
GGGGGAGCTGGACGGCATGAGGAGCTGGCACGGCTGGTGGATGAGGATATCTTGCATTGGATTGAGAGCGAGAAT
CTATATTGCAATCATGTACAGAGCTCATCATGA
Transcript >Ophun1|4693
ATGTCCTCTCCAAAGAGGAGCCTCGTCGACACCTTTACCCGCCGCCTGGCCGCATTCCACGCCTCCGCCCTCCCC
CTTCAGATTCTCAGTACGCACCCATGTCCGACGTCGACGCTGCCCAGCCGCCTGCTGGTGCTGGACTCGAGCTTC
AACCCTCCGACGATGGCGCACGCGCAGATGGCACGCGAAGCACTGCGCAAACACGACCGGCTCATGCTGTTGCTC
TCTGTGGCGAATGCGGATAAGAGGGTCCAGCCTGCGGGGTTTGCGTCGCGGTTGTGCTTGATGGATGTGCTGGCG
AGGAAGATGGCGGTGGATGGGGCTGTGGTTGACTTGGCGGTTACGACGAGGCCTCTTTTCGCGGACAAGGTTGCT
CCTGTGGCGGATAGTGGCGTCTATGAGGAGGTTGTCTTCCTCGTTGGCTTCGACACGCTGGTGCGCATCCTTGAT
GTGAAATACTACGACGACGCGGATAAGAGGGACGTGGTGCTCGCCTCGTTCTTCCGTCGCGCTCGCCTGCTCGTC
TTCATCAGACCGTCTGACGTATGGGGCTCGGCGGATGAGCAGCGTCGGTTCGTAGAAGAGAGCGCGTGGAGGAGT
CGCGTTGATGTTCGTTTTGGTGATGAGACGGAGGGTGTTAGCAGCTCGCGGGTTAGGGAGCTGGTGCGTATGCCT
GGGGGAGCTGGACGGCATGAGGAGCTGGCACGGCTGGTGGATGAGGATATCTTGCATTGGATTGAGAGCGAGAAT
CTATATTGCAATCATGTACAGAGCTCATCATGA
Gene >Ophun1|4693
ATGTCCTCTCCAAAGAGGAGCCTCGTCGACACCTTTACCCGCCGCCTGGCCGCATTCCACGCCTCCGCCCTCCCC
CTTCAGATTCTCAGTACGCACCCATGTCCGACGTCGACGCTGCCCAGCCGCCTGCTGGTGCTGGACTCGAGCTTC
AACCCTCCGACGATGGCGCACGCGCAGATGGCACGCGAAGCACTGCGCAAACACGACCGGCTCATGCTGTTGCTC
TCTGTGGCGAATGCGGATAAGAGGGTCCAGCCTGCGGGGTTTGCGTCGCGGTTGTGCTTGATGGATGTGCTGGCG
AGGAAGATGGCGGTGGATGGGGCTGTGGTTGACTTGGCGGTTACGACGAGGCCTCTTTTCGCGGACAAGGTTGCT
CCTGTGGCGGATAGTGGCGTCTATGAGGAGGTTGTCTTCCTCGTTGGCTTCGACACGCTGGTGCGCATCCTTGAT
GTGAAATACTACGACGACGCGGATAAGAGGGACGTGGTGCTCGCCTCGTTCTTCCGTCGCGCTCGCCTGCTCGTC
TTCATCAGACCGTCTGACGTATGGGGCTCGGCGGATGAGCAGCGTCGGTTCGTAGAAGAGAGCGCGTGGAGGAGT
CGCGTTGATGTTCGTTTTGGTGATGAGACGGAGGGTGTTAGCAGCTCGCGGGTTAGGGAGCTGGTGCGTATGCCT
GGGGGAGCTGGACGGCATGAGGAGCTGGCACGGCTGGTGGATGAGGATATCTTGCATTGGATTGAGAGCGAGAAT
CTATATTGCAATCATGTACAGAGCTCATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail