Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4690
Gene name
LocationContig_439:8142..10831
Strand+
Gene length (bp)2689
Transcript length (bp)2604
Coding sequence length (bp)2604
Protein length (aa) 868

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.2E-168 153 824

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 61 862 5.0E-150
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 54 867 7.0E-142
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 133 861 3.0E-122
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 122 841 9.0E-119
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 133 851 1.0E-116
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 61 862 5.0E-150
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 54 867 7.0E-142
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 133 861 3.0E-122
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 122 841 9.0E-119
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 133 851 1.0E-116
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 57 861 1.0E-113
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 133 857 5.0E-111
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 135 849 2.0E-108
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 133 849 5.0E-108
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 112 857 3.0E-106
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 116 849 2.0E-95
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 138 849 5.0E-95
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 138 849 2.0E-90
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 138 849 4.0E-90
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 159 176 17
2 229 251 22
3 266 288 22
4 335 357 22
5 412 434 22
6 479 501 22
7 547 569 22
8 574 593 19
9 656 675 19
10 696 713 17
11 723 745 22
12 766 788 22
13 803 825 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4690
MASSPSPSSSPDDDDKNRAVTNEKARDSPFTYDEDDDDDVCAGRLRATTEHDLDVTEDDLLEAKELASQYTLQQV
RQVMIRVRRVHEKDPNFPAAVMGKIQAFLDNEAVFARPEKHQHLIQEMKLEAALVSCNSPYAEVRAVVSNRDDPS
TPCSTIRSWAIGLVFAVLLAFVNQLFEIRQPAIRVMANVAQLLAYPLGKAAENWLPDRAVTVWGVRHSLNPGPFS
KKEHMLITIMANVAYNTPYTNYIIWVQFLPQYFDQPYASHFAYQLLIALATNFIGYGIAGVCRRFLVYPSYCVWP
ASLVTIALNSAFHTDVNPPVEGPLRRVWRLSRIRFFYLMFACMFLWFWLPGYVWVGLSKFNWLGWISPTNRHLNV
VTGINNGLGVNPFPTWDWNVLLWDSADPLMVPFFSTLNRFVGVFASFWLVLGLWYSNAFNTGYLPINTNRVYDHF
AQLYNITRATDDHGLFNQTKYEQYSPPFLGAGNLVIYVFFFGIYTSTLTYAALYHRHQIAMGFKALWRSLRRRQP
PRRHSLDVHSRLMAAYPEVPDWWYLACLVCAMAFGVAAIAAWNTHTSPVVVLYGLALCVVFVIPVGIIKAMTGIE
VTLNVLAEFVGGSWVDGNALAMNYFKSFGYVTCAHAIWFCNDLKLAHYVKIPPRHTFVAQMAATFVSTLVCIGVL
NFQMLSIDDVCTPYAQYKLTCPGVNTFFTASVLWGTVGPDRIFGHRGQYSAALVGFPLGVIIVVFFWLLGRRFPR
WDWVRQIHPVAIMYGGIVWAPYNMSYVWPSVPIAWFSWIYLKSRYLGLWSKYNFVLSAAWSCGIAIAGIIIFFAL
QYTGTDLDWWGNRIVDAGCEGKACTLKTLAPGEYFGPRVGDF*
Coding >Ophun1|4690
ATGGCCTCCTCCCCCTCCCCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCACCAACGAAAAGGCG
CGGGACTCGCCCTTTACCTACGACGAGGACGACGATGACGATGTCTGCGCTGGCAGGCTGCGAGCCACGACGGAG
CACGACCTCGACGTGACCGAAGATGACCTCCTCGAAGCCAAGGAGCTGGCTTCGCAATACACGCTCCAGCAAGTG
CGCCAGGTCATGATCCGGGTGCGGCGCGTCCACGAAAAAGATCCCAACTTCCCCGCCGCCGTCATGGGCAAGATC
CAGGCCTTTCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAGCATCTGATACAAGAGATGAAGCTC
GAGGCCGCCCTCGTCAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAATCGCGATGATCCCTCG
ACACCTTGCTCGACGATACGCTCGTGGGCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATCCGTCAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTTCTCGCCTACCCTCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCCGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGGCCCTTTTCC
AAAAAGGAGCACATGCTCATCACCATCATGGCAAACGTCGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAGTTCCTCCCCCAGTACTTTGACCAGCCCTACGCCTCCCACTTCGCCTATCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGTTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCA
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTTCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTACGC
CGCGTCTGGCGCCTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCACCGACCAACCGCCACCTCAACGTC
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCAGACCCGCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGTCTCTGGTACTCAAACGCCTTCAACACGGGTTACCTGCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACCGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCAATACTCG
CCCCCCTTCCTCGGCGCCGGCAACCTCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTCACCTAC
GCCGCCCTCTACCACCGCCATCAGATCGCCATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCG
CCCCGTCGTCACTCCCTCGACGTCCACAGCCGTCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTC
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATCGCCGCCTGGAACACGCACACGTCACCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGATCCTGGGTCGACGGAAACGCCCTGGCCATGAACTACTTC
AAATCCTTTGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTCGCCCACTACGTCAAG
ATCCCCCCGAGACACACCTTTGTCGCCCAGATGGCCGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGCACCGTCGGCCCGGACCGCATCTTCGGTCACAGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCTCTGGGCGTCATCATCGTCGTCTTCTTCTGGCTCCTCGGCCGCCGTTTTCCCCGC
TGGGATTGGGTCCGCCAGATTCATCCCGTCGCCATCATGTACGGCGGCATCGTCTGGGCTCCCTACAACATGTCG
TACGTCTGGCCCTCGGTGCCCATAGCCTGGTTCTCGTGGATCTACCTCAAGTCGCGCTATCTCGGCCTGTGGTCC
AAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTTCTTCGCCCTC
CAGTACACAGGCACCGACCTCGACTGGTGGGGCAACCGCATCGTCGACGCCGGCTGCGAGGGCAAGGCTTGCACC
CTCAAGACGCTCGCTCCCGGCGAGTATTTCGGCCCACGCGTCGGCGATTTCTAG
Transcript >Ophun1|4690
ATGGCCTCCTCCCCCTCCCCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCACCAACGAAAAGGCG
CGGGACTCGCCCTTTACCTACGACGAGGACGACGATGACGATGTCTGCGCTGGCAGGCTGCGAGCCACGACGGAG
CACGACCTCGACGTGACCGAAGATGACCTCCTCGAAGCCAAGGAGCTGGCTTCGCAATACACGCTCCAGCAAGTG
CGCCAGGTCATGATCCGGGTGCGGCGCGTCCACGAAAAAGATCCCAACTTCCCCGCCGCCGTCATGGGCAAGATC
CAGGCCTTTCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAGCATCTGATACAAGAGATGAAGCTC
GAGGCCGCCCTCGTCAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAATCGCGATGATCCCTCG
ACACCTTGCTCGACGATACGCTCGTGGGCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATCCGTCAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTTCTCGCCTACCCTCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCCGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGGCCCTTTTCC
AAAAAGGAGCACATGCTCATCACCATCATGGCAAACGTCGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAGTTCCTCCCCCAGTACTTTGACCAGCCCTACGCCTCCCACTTCGCCTATCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGTTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCA
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTTCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTACGC
CGCGTCTGGCGCCTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCACCGACCAACCGCCACCTCAACGTC
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCAGACCCGCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGTCTCTGGTACTCAAACGCCTTCAACACGGGTTACCTGCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACCGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCAATACTCG
CCCCCCTTCCTCGGCGCCGGCAACCTCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTCACCTAC
GCCGCCCTCTACCACCGCCATCAGATCGCCATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCG
CCCCGTCGTCACTCCCTCGACGTCCACAGCCGTCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTC
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATCGCCGCCTGGAACACGCACACGTCACCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGATCCTGGGTCGACGGAAACGCCCTGGCCATGAACTACTTC
AAATCCTTTGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTCGCCCACTACGTCAAG
ATCCCCCCGAGACACACCTTTGTCGCCCAGATGGCCGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGCACCGTCGGCCCGGACCGCATCTTCGGTCACAGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCTCTGGGCGTCATCATCGTCGTCTTCTTCTGGCTCCTCGGCCGCCGTTTTCCCCGC
TGGGATTGGGTCCGCCAGATTCATCCCGTCGCCATCATGTACGGCGGCATCGTCTGGGCTCCCTACAACATGTCG
TACGTCTGGCCCTCGGTGCCCATAGCCTGGTTCTCGTGGATCTACCTCAAGTCGCGCTATCTCGGCCTGTGGTCC
AAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTTCTTCGCCCTC
CAGTACACAGGCACCGACCTCGACTGGTGGGGCAACCGCATCGTCGACGCCGGCTGCGAGGGCAAGGCTTGCACC
CTCAAGACGCTCGCTCCCGGCGAGTATTTCGGCCCACGCGTCGGCGATTTCTAG
Gene >Ophun1|4690
ATGGCCTCCTCCCCCTCCCCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCACCAACGAAAAGGCG
CGGGACTCGCCCTTTACCTACGACGAGGACGACGATGACGATGTCTGCGCTGGCAGGCTGCGAGCCACGACGGAG
CACGACCTCGACGTGACCGAAGATGACCTCCTCGAAGCCAAGGAGCTGGCTTCGCAATACACGCTCCAGCAAGTG
CGCCAGGTCATGATCCGGGTGCGGCGCGTCCACGAAAAAGATCCCAACTTCCCCGCCGCCGTCATGGGCAAGATC
CAGGCCTTTCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAGCATCTGATACAAGAGATGAAGCTC
GAGGCCGCCCTCGTCAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAATCGCGATGATCCCTCG
ACACCTTGCTCGACGATACGCTCGTGGGCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATCCGTCAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTTCTCGCCTACCCTCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCCGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGGCCCTTTTCC
AAAAAGGAGCACATGCTCATCACCATCATGGCAAACGTCGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAGTTCCTCCCCCAGTACTTTGACCAGCCCTACGCCTCCCACTTCGCCTATCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGTTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCA
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTTCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTACGC
CGCGTCTGGCGCCTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCACCGACCAACCGCCACCTCAACGTC
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCAGACCCGCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGTCTCTGGTACTCAAACGCCTTCAACACGGGTTACCTGCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACCGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCAATACTCG
CCCCCCTTCCTCGGCGCCGGCAACCTCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTCACCTAC
GCCGCCCTCTACCACCGCCATCAGATCGCCATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCG
CCCCGTCGTCACTCCCTCGACGTCCACAGCCGTCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTC
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATCGCCGCCTGGAACACGCACACGTCACCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGATCCTGGGTCGACGGAAACGCCCTGGCCATGAACTACTTC
AAATCCTTTGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTCGCCCACTACGTCAAG
ATCCCCCCGAGACACACCTTTGTCGCCCAGATGGCCGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGCACCGTCGGCCCGGACCGCATCTTCGGTCACAGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCTCTGGGCGTCATCATCGTCGTCTTCTTCTGGCTCCTCGGCCGCCGTTTTCCCCGC
TGGGATTGGGTCCGCCAGATTCATCCCGTCGCCATCATGTACGGCGGCATCGTCTGGGCTCCCTACAACATGTCG
TACGTCTGGCCCTCGGTGCCCATAGCCTGGTTCTCGTGGATCTACCTCAAGTCGCGCTATCTCGGCCTGTGGTCC
AAGGTATGTGTATATATATATATATATATATATCCCAACCTCTCCTCACCTTCTGAACCACAATCAACGACACTG
ACTTCCCAAACAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTT
CTTCGCCCTCCAGTACACAGGCACCGACCTCGACTGGTGGGGCAACCGCATCGTCGACGCCGGCTGCGAGGGCAA
GGCTTGCACCCTCAAGACGCTCGCTCCCGGCGAGTATTTCGGCCCACGCGTCGGCGATTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail