Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4686
Gene name
LocationContig_438:10937..12704
Strand+
Gene length (bp)1767
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14479 HeLo Prion-inhibition and propagation 1.8E-24 17 210

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5652
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1703
Ophiocordyceps australis map64 (Brazil) OphauB2|5652
Ophiocordyceps camponoti-rufipedis Ophun1|4686 (this protein)
Ophiocordyceps kimflemingae Ophio5|4672
Ophiocordyceps subramaniannii Hirsu2|8023

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4686
MEAGLYVHLAYHSACLCITTLRNSLHYARDADRLNLGLEIERYRLQVWGENMGLKPANENSAPKLPPRLDLISDI
LARQLDGIAALLRDADVLRERYGLVVTENKATGSERVRALLERMQRCIPRLEGHDGGGDGVGLETRRLARTTSAP
LRLRWAVRDVEKFQKLLDDLSSRISQLNQLLTETQQRETEREWERFLIRLVDSVHDKQTLDLVLQTAPPTSSTRF
RAECKAISADVPWSSAPSTPIQQISISEFILPDAYDSMKRFVAGKREPEGSWLFERKDFDRDIGQDDKRRLVGRL
QLLVLMLAKKKTAAFRTPLAEGCINDGSHFCWWMVYRLSTSQLVPPPEPKPLSLLHLLQPKTKFQPALELRYKLA
SRLCTTLFELYSSSWLHKGVRSANVLFTVSSLTQMSRVLESMVLCGFDYSRQESEQSTIDRARLVADVETALYRH
PRYQGDAAEGYKLAYDIYSLGLVLVEIALWKPLSSFLEGKPIGKSSASASQLAPNMTIFHEAEATMLKKRVMNRV
ESEFRFRVGSAYYQATKYCLELADRETAAEGDVFAAHPSLEFYDAVVVPLASLADSQGVKGVD*
Coding >Ophun1|4686
ATGGAAGCAGGCCTCTACGTCCACCTCGCCTACCACAGCGCATGCCTCTGCATCACCACCCTCCGCAACAGCCTC
CACTACGCCCGCGACGCCGACCGCCTCAACCTCGGCCTCGAGATTGAGCGCTACCGGCTGCAAGTCTGGGGCGAG
AACATGGGCTTGAAACCCGCGAATGAGAACTCGGCCCCCAAGTTACCTCCTCGGCTGGACCTCATCAGCGATATC
CTCGCCCGCCAGCTGGATGGTATTGCGGCGTTGCTGAGGGATGCGGATGTGTTGCGGGAGAGGTATGGCTTGGTG
GTTACCGAGAATAAGGCGACGGGTTCGGAGAGGGTGAGGGCGTTGCTGGAGAGGATGCAGCGTTGTATCCCTAGA
CTCGAGGGTCATGATGGTGGTGGTGATGGTGTTGGCTTGGAGACGAGGAGGCTTGCAAGGACGACTTCTGCGCCG
TTGCGTCTGCGGTGGGCGGTTCGTGACGTGGAAAAGTTCCAGAAACTGTTGGACGACCTCTCCTCCCGAATCAGC
CAACTCAACCAACTCCTCACCGAAACCCAACAACGCGAAACCGAACGAGAATGGGAACGATTCCTAATCAGGCTC
GTCGACAGCGTCCACGACAAGCAAACCCTAGACCTCGTCCTCCAAACCGCACCGCCAACATCGTCCACCCGCTTC
AGAGCGGAATGCAAGGCCATCTCCGCCGACGTCCCCTGGTCTTCCGCGCCCTCGACGCCCATTCAGCAGATCAGT
ATATCCGAGTTCATCCTTCCCGACGCCTACGACTCTATGAAGCGCTTTGTTGCGGGGAAGAGGGAGCCGGAGGGG
AGTTGGCTGTTTGAACGCAAGGACTTTGATCGGGATATTGGACAGGATGATAAGAGGAGGCTCGTTGGCAGGCTG
CAGCTTCTGGTCTTGATGCTTGCCAAGAAAAAGACTGCTGCTTTTCGAACGCCACTGGCTGAGGGGTGTATCAAC
GACGGTTCCCATTTCTGCTGGTGGATGGTATACAGACTCTCAACCTCACAGCTCGTCCCCCCCCCTGAACCAAAG
CCCCTATCCCTCCTCCACCTGCTACAACCAAAGACCAAGTTCCAGCCCGCGCTGGAACTGCGGTACAAGCTGGCC
AGCAGGTTGTGCACCACCCTCTTCGAGCTGTATTCCAGCAGCTGGCTGCACAAGGGCGTGCGGAGCGCCAACGTG
CTGTTTACGGTCTCGTCTCTGACGCAGATGAGCCGCGTCCTCGAGTCAATGGTTCTCTGTGGCTTTGATTACTCT
CGTCAGGAGAGCGAGCAGTCTACCATTGATAGGGCGAGGTTGGTCGCTGATGTTGAGACGGCGCTTTATCGTCAT
CCGAGGTATCAGGGTGATGCGGCAGAGGGATACAAGCTGGCGTACGACATTTACTCGCTGGGCCTCGTCCTGGTG
GAAATCGCGTTGTGGAAGCCGCTGTCTTCGTTTCTCGAGGGTAAGCCCATTGGCAAGTCATCAGCTTCAGCATCA
CAGCTGGCTCCCAACATGACCATCTTCCACGAAGCCGAAGCCACAATGCTGAAGAAACGGGTCATGAACAGGGTA
GAGTCCGAGTTTCGCTTCCGCGTCGGGTCGGCGTATTACCAGGCTACCAAATACTGTCTAGAGCTGGCGGATCGC
GAGACGGCTGCTGAGGGGGACGTCTTTGCTGCTCACCCTTCGCTCGAGTTTTACGACGCTGTTGTGGTGCCCTTG
GCGAGCTTGGCTGATTCTCAGGGGGTCAAGGGAGTTGATTGA
Transcript >Ophun1|4686
ATGGAAGCAGGCCTCTACGTCCACCTCGCCTACCACAGCGCATGCCTCTGCATCACCACCCTCCGCAACAGCCTC
CACTACGCCCGCGACGCCGACCGCCTCAACCTCGGCCTCGAGATTGAGCGCTACCGGCTGCAAGTCTGGGGCGAG
AACATGGGCTTGAAACCCGCGAATGAGAACTCGGCCCCCAAGTTACCTCCTCGGCTGGACCTCATCAGCGATATC
CTCGCCCGCCAGCTGGATGGTATTGCGGCGTTGCTGAGGGATGCGGATGTGTTGCGGGAGAGGTATGGCTTGGTG
GTTACCGAGAATAAGGCGACGGGTTCGGAGAGGGTGAGGGCGTTGCTGGAGAGGATGCAGCGTTGTATCCCTAGA
CTCGAGGGTCATGATGGTGGTGGTGATGGTGTTGGCTTGGAGACGAGGAGGCTTGCAAGGACGACTTCTGCGCCG
TTGCGTCTGCGGTGGGCGGTTCGTGACGTGGAAAAGTTCCAGAAACTGTTGGACGACCTCTCCTCCCGAATCAGC
CAACTCAACCAACTCCTCACCGAAACCCAACAACGCGAAACCGAACGAGAATGGGAACGATTCCTAATCAGGCTC
GTCGACAGCGTCCACGACAAGCAAACCCTAGACCTCGTCCTCCAAACCGCACCGCCAACATCGTCCACCCGCTTC
AGAGCGGAATGCAAGGCCATCTCCGCCGACGTCCCCTGGTCTTCCGCGCCCTCGACGCCCATTCAGCAGATCAGT
ATATCCGAGTTCATCCTTCCCGACGCCTACGACTCTATGAAGCGCTTTGTTGCGGGGAAGAGGGAGCCGGAGGGG
AGTTGGCTGTTTGAACGCAAGGACTTTGATCGGGATATTGGACAGGATGATAAGAGGAGGCTCGTTGGCAGGCTG
CAGCTTCTGGTCTTGATGCTTGCCAAGAAAAAGACTGCTGCTTTTCGAACGCCACTGGCTGAGGGGTGTATCAAC
GACGGTTCCCATTTCTGCTGGTGGATGGTATACAGACTCTCAACCTCACAGCTCGTCCCCCCCCCTGAACCAAAG
CCCCTATCCCTCCTCCACCTGCTACAACCAAAGACCAAGTTCCAGCCCGCGCTGGAACTGCGGTACAAGCTGGCC
AGCAGGTTGTGCACCACCCTCTTCGAGCTGTATTCCAGCAGCTGGCTGCACAAGGGCGTGCGGAGCGCCAACGTG
CTGTTTACGGTCTCGTCTCTGACGCAGATGAGCCGCGTCCTCGAGTCAATGGTTCTCTGTGGCTTTGATTACTCT
CGTCAGGAGAGCGAGCAGTCTACCATTGATAGGGCGAGGTTGGTCGCTGATGTTGAGACGGCGCTTTATCGTCAT
CCGAGGTATCAGGGTGATGCGGCAGAGGGATACAAGCTGGCGTACGACATTTACTCGCTGGGCCTCGTCCTGGTG
GAAATCGCGTTGTGGAAGCCGCTGTCTTCGTTTCTCGAGGGTAAGCCCATTGGCAAGTCATCAGCTTCAGCATCA
CAGCTGGCTCCCAACATGACCATCTTCCACGAAGCCGAAGCCACAATGCTGAAGAAACGGGTCATGAACAGGGTA
GAGTCCGAGTTTCGCTTCCGCGTCGGGTCGGCGTATTACCAGGCTACCAAATACTGTCTAGAGCTGGCGGATCGC
GAGACGGCTGCTGAGGGGGACGTCTTTGCTGCTCACCCTTCGCTCGAGTTTTACGACGCTGTTGTGGTGCCCTTG
GCGAGCTTGGCTGATTCTCAGGGGGTCAAGGGAGTTGATTGA
Gene >Ophun1|4686
ATGGAAGCAGGCCTCTACGTCCACCTCGCCTACCACAGCGCATGCCTCTGCATCACCACCCTCCGCAACAGCCTC
CACTACGCCCGCGACGCCGACCGCCTCAACCTCGGCCTCGAGATTGAGCGCTACCGGCTGCAAGTCTGGGGCGAG
AACATGGGCTTGAAACCCGCGAATGAGAACTCGGCCCCCAAGTTACCTCCTCGGCTGGACCTCATCAGCGATATC
CTCGCCCGCCAGCTGGATGGTATTGCGGCGTTGCTGAGGGATGCGGATGTGTTGCGGGAGAGGTATGGCTTGGTG
GTTACCGAGAATAAGGCGACGGGTTCGGAGAGGGTGAGGGCGTTGCTGGAGAGGATGCAGCGTTGTATCCCTAGA
CTCGAGGGTCATGATGGTGGTGGTGATGGTGTTGGCTTGGAGACGAGGAGGCTTGCAAGGACGACTTCTGCGCCG
TTGCGTCTGCGGTGGGCGGTTCGTGACGTGGAAAAGTTCCAGAAACTGTTGGACGACCTCTCCTCCCGAATCAGC
CAACTCAACCAACTCCTCACCGAAACCCAACAACGCGAAACCGAACGAGAATGGGAACGATTCCTAATCAGGCTC
GTCGACAGCGTCCACGACAAGCAAACCCTAGACCTCGTCCTCCAAACCGCACCGCCAACATCGTCCACCCGCTTC
AGAGCGGAATGCAAGGCCATCTCCGCCGACGTCCCCTGGTCTTCCGCGCCCTCGACGCCCATTCAGCAGATCAGT
ATATCCGAGTTCATCCTTCCCGACGCCTACGACTCTATGAAGCGCTTTGTTGCGGGGAAGAGGGAGCCGGAGGGG
AGTTGGCTGTTTGAACGCAAGGACTTTGATCGGGATATTGGACAGGATGATAAGAGGAGGCTCGTTGGCAGGCTG
CAGCTTCTGGTCTTGATGCTTGCCAAGAAAAAGACTGCTGCTTTTCGAACGCCACTGGCTGAGGGGTGTATCAAC
GACGGTTCCCATTTCTGCTGGTGGATGGTATACAGACTCTCAACCTCACAGCTCGTCCCCCCCCCTGAACCAAAG
CCCCTATCCCTCCTCCACCTGCTACAACCAAAGACCAAGTTCCAGCCCGCGCTGGAACTGCGGTACAAGCTGGCC
AGCAGGTTGTGCACCACCCTCTTCGAGCTGTATTCCAGCAGCTGGCTGCACAAGGGCGTGCGGAGCGCCAACGTG
CTGTTTACGGTCTCGTCTCTGACGCAGATGAGCCGCGTCCTCGAGTCAATGGTTCTCTGTGGCTTTGATTACTCT
CGTCAGGAGAGCGAGCAGTCTACCATTGATAGGGCGAGGTTGGTCGCTGATGTTGAGACGGCGCTTTATCGTCAT
CCGAGGTATCAGGGTGATGCGGCAGAGGGATACAAGCTGGCGTACGACATTTACTCGCTGGGCCTCGTCCTGGTG
GAAATCGCGTTGTGGAAGCCGCTGTCTTCGTTTCTCGAGGGTAAGCCCATTGGCAAGTCATCAGCTTCAGCATCA
CAGCTGGCTCCCAACATGACCATCTTCCACGAAGCCGAAGCCACAATGCTGAAGAAACGGGTCATGAACAGGGTA
GAGTCCGAGTTTCGCTTCCGCGTCGGGTCGGCGTATTACCAGGCTACCAAATACTGTCTAGAGCTGGCGGATCGC
GAGACGGCTGCTGAGGGGGACGTCTTTGCTGCTCACCCTTCGCTCGAGTTTTACGACGCTGTTGTGGTGCCCTTG
GCGAGCTTGGCTGATTCTCAGGGGGTCAAGGGAGTTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail