Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4685
Gene name
LocationContig_438:6524..10586
Strand-
Gene length (bp)4062
Transcript length (bp)3708
Coding sequence length (bp)3708
Protein length (aa) 1236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.3E-22 87 293
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.2E-14 105 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 102 292 3.0E-11
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 140 289 1.0E-10
sp|Q5VJL3|GDT9_DICDI Probable serine/threonine-protein kinase gdt9 OS=Dictyostelium discoideum GN=gdt9 PE=2 SV=2 189 294 5.0E-10
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 141 395 5.0E-10
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 141 292 8.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 102 292 3.0E-11
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 140 289 1.0E-10
sp|Q5VJL3|GDT9_DICDI Probable serine/threonine-protein kinase gdt9 OS=Dictyostelium discoideum GN=gdt9 PE=2 SV=2 189 294 5.0E-10
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 141 395 5.0E-10
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 141 292 8.0E-10
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 688 860 3.0E-09
sp|Q55CY9|GDT8_DICDI Probable serine/threonine-protein kinase gdt8 OS=Dictyostelium discoideum GN=gdt8 PE=3 SV=1 164 294 3.0E-09
sp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=2 SV=1 88 287 4.0E-09
sp|A8R7E6|CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1 88 292 4.0E-09
sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 89 288 5.0E-09
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 88 292 7.0E-09
sp|Q8RY67|WAKLO_ARATH Wall-associated receptor kinase-like 14 OS=Arabidopsis thaliana GN=WAKL14 PE=2 SV=2 84 288 9.0E-09
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 90 292 1.0E-08
sp|O22187|Y2232_ARATH Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=3 SV=1 165 293 1.0E-08
sp|Q54TH6|Y9863_DICDI Probable serine/threonine-protein kinase DDB_G0281745 OS=Dictyostelium discoideum GN=DDB_G0281745 PE=3 SV=1 118 288 2.0E-08
sp|Q54QQ1|PHG2_DICDI Serine/threonine-protein kinase phg2 OS=Dictyostelium discoideum GN=phg2 PE=1 SV=1 88 295 2.0E-08
sp|Q9FID6|Y5392_ARATH Probable receptor-like protein kinase At5g39020 OS=Arabidopsis thaliana GN=At5g39020 PE=2 SV=1 89 288 3.0E-08
sp|P43298|TMK1_ARATH Receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1 84 288 3.0E-08
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 76 289 3.0E-08
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 141 353 3.0E-08
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 88 304 3.0E-08
sp|Q9FLW0|Y5241_ARATH Probable receptor-like protein kinase At5g24010 OS=Arabidopsis thaliana GN=At5g24010 PE=1 SV=1 69 292 3.0E-08
sp|Q54H46|DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum GN=drkA PE=3 SV=1 77 291 4.0E-08
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 84 293 4.0E-08
sp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g59700 OS=Arabidopsis thaliana GN=At5g59700 PE=3 SV=1 89 292 5.0E-08
sp|D7SFH9|GPDL2_ARATH Glycerophosphodiester phosphodiesterase protein kinase domain-containing GDPDL2 OS=Arabidopsis thaliana GN=GDPDL2 PE=1 SV=1 89 292 5.0E-08
sp|Q55GE6|ROCO7_DICDI Probable serine/threonine-protein kinase roco7 OS=Dictyostelium discoideum GN=roco7 PE=3 SV=1 141 292 6.0E-08
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 87 288 6.0E-08
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 141 292 6.0E-08
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 141 290 6.0E-08
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 141 298 7.0E-08
sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=3 SV=1 89 307 7.0E-08
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 124 292 8.0E-08
sp|O48814|BIK1_ARATH Serine/threonine-protein kinase BIK1 OS=Arabidopsis thaliana GN=BIK1 PE=1 SV=1 103 292 8.0E-08
sp|Q9ASQ6|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana GN=RFK1 PE=2 SV=3 67 287 1.0E-07
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 132 323 1.0E-07
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 141 292 2.0E-07
sp|Q54Y90|Y0133_DICDI Probable serine/threonine-protein kinase DDB_G0278665 OS=Dictyostelium discoideum GN=DDB_G0278665 PE=3 SV=1 88 294 2.0E-07
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 86 293 2.0E-07
sp|P0C5E2|Y1839_ARATH Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=2 SV=2 61 288 2.0E-07
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 680 875 2.0E-07
sp|Q95UN8|M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster GN=slpr PE=1 SV=1 164 292 2.0E-07
sp|Q9S7D9|ACCR1_ARATH Serine/threonine-protein kinase-like protein CCR1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 38 243 3.0E-07
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 89 304 3.0E-07
sp|Q3EDL4|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2 89 309 3.0E-07
sp|Q41328|PTI1_SOLLC Pto-interacting protein 1 OS=Solanum lycopersicum GN=PTI1 PE=1 SV=2 85 292 3.0E-07
sp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1 88 292 4.0E-07
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 88 366 4.0E-07
sp|Q13546|RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=RIPK1 PE=1 SV=3 109 302 4.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 107 292 4.0E-07
sp|Q9ESL4|MLTK_MOUSE Mitogen-activated protein kinase kinase kinase MLT OS=Mus musculus GN=Zak PE=1 SV=1 141 292 4.0E-07
sp|Q54G43|SHKE_DICDI Dual specificity protein kinase shkE OS=Dictyostelium discoideum GN=shkE PE=3 SV=1 140 299 4.0E-07
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 88 366 4.0E-07
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 103 269 5.0E-07
sp|Q96S53|TESK2_HUMAN Dual specificity testis-specific protein kinase 2 OS=Homo sapiens GN=TESK2 PE=1 SV=1 141 288 5.0E-07
sp|Q54VC0|Y9865_DICDI Probable serine/threonine-protein kinase DDB_G0280461 OS=Dictyostelium discoideum GN=DDB_G0280461 PE=3 SV=1 105 343 5.0E-07
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 141 340 5.0E-07
sp|Q9NYL2|MLTK_HUMAN Mitogen-activated protein kinase kinase kinase MLT OS=Homo sapiens GN=ZAK PE=1 SV=3 141 292 7.0E-07
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 141 343 7.0E-07
sp|Q6NKZ9|Y4345_ARATH Probable receptor-like serine/threonine-protein kinase At4g34500 OS=Arabidopsis thaliana GN=At4g34500 PE=2 SV=1 89 309 7.0E-07
sp|Q0WRY5|CDL1_ARATH Serine/threonine-protein kinase CDL1 OS=Arabidopsis thaliana GN=CDL1 PE=1 SV=1 113 288 7.0E-07
sp|Q8H1G6|PTI11_ARATH PTI1-like tyrosine-protein kinase 1 OS=Arabidopsis thaliana GN=PTI11 PE=1 SV=1 141 288 7.0E-07
sp|Q54TA1|DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum GN=drkC PE=3 SV=1 141 290 7.0E-07
sp|Q9FM85|Y5564_ARATH Probable receptor-like protein kinase At5g56460 OS=Arabidopsis thaliana GN=At5g56460 PE=2 SV=1 141 288 8.0E-07
sp|Q60855|RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Ripk1 PE=1 SV=1 122 289 8.0E-07
sp|Q55EI8|Y9956_DICDI Probable serine/threonine-protein kinase DDB_G0268876 OS=Dictyostelium discoideum GN=DDB_G0268876 PE=3 SV=1 165 292 8.0E-07
sp|P0CD62|LIMKB_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0286997 OS=Dictyostelium discoideum GN=DDB_G0286997 PE=3 SV=1 141 292 8.0E-07
sp|Q552C1|Y9957_DICDI Probable serine/threonine-protein kinase DDB_G0276181 OS=Dictyostelium discoideum GN=DDB_G0276181 PE=3 SV=1 119 292 8.0E-07
sp|Q66L42|M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus GN=Map3k10 PE=1 SV=2 141 292 9.0E-07
sp|Q924U5|TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus GN=Tesk2 PE=2 SV=1 141 296 9.0E-07
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 87 290 1.0E-06
sp|Q9LRP3|Y3174_ARATH Probable receptor-like protein kinase At3g17420 OS=Arabidopsis thaliana GN=At3g17420 PE=1 SV=1 35 288 1.0E-06
sp|O49840|APK2B_ARATH Protein kinase 2B, chloroplastic OS=Arabidopsis thaliana GN=APK2B PE=2 SV=1 141 292 1.0E-06
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 184 292 1.0E-06
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 105 288 1.0E-06
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 141 328 2.0E-06
sp|Q02779|M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens GN=MAP3K10 PE=1 SV=3 141 292 2.0E-06
sp|Q55DU7|GDT4_DICDI Probable serine/threonine-protein kinase gdt4 OS=Dictyostelium discoideum GN=gdt4 PE=3 SV=2 141 292 2.0E-06
sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=2 SV=2 141 287 2.0E-06
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 97 292 2.0E-06
sp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1 165 302 2.0E-06
sp|Q9FID5|Y5393_ARATH Probable receptor-like protein kinase At5g39030 OS=Arabidopsis thaliana GN=At5g39030 PE=2 SV=1 141 288 2.0E-06
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 89 288 2.0E-06
sp|Q3ECH2|Y1670_ARATH Probable receptor-like protein kinase At1g67000 OS=Arabidopsis thaliana GN=At1g67000 PE=2 SV=2 141 288 2.0E-06
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 84 288 2.0E-06
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 141 292 3.0E-06
sp|Q9FIJ6|ACCR4_ARATH Serine/threonine-protein kinase-like protein CCR4 OS=Arabidopsis thaliana GN=CCR4 PE=1 SV=1 141 288 3.0E-06
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 89 293 3.0E-06
sp|O80719|Y2706_ARATH Probable receptor-like protein kinase At2g47060 OS=Arabidopsis thaliana GN=At2g47060 PE=1 SV=1 141 292 3.0E-06
sp|Q9M8T0|Y3288_ARATH Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana GN=At3g02880 PE=1 SV=1 89 292 3.0E-06
sp|Q9FYK0|TMK2_ARATH Receptor-like kinase TMK2 OS=Arabidopsis thaliana GN=TMK2 PE=2 SV=1 86 292 3.0E-06
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 70 340 3.0E-06
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 90 287 4.0E-06
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 89 288 4.0E-06
sp|Q9ZNQ8|PERK4_ARATH Proline-rich receptor-like protein kinase PERK4 OS=Arabidopsis thaliana GN=PERK4 PE=1 SV=1 44 302 4.0E-06
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 105 267 4.0E-06
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 141 340 5.0E-06
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 141 340 6.0E-06
sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 88 292 6.0E-06
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 89 292 7.0E-06
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 104 288 7.0E-06
sp|Q9ZRF9|RPK1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RPK1 OS=Arabidopsis thaliana GN=RPK1 PE=1 SV=1 141 294 7.0E-06
sp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1 164 335 7.0E-06
sp|Q9LV48|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1 OS=Arabidopsis thaliana GN=PERK1 PE=2 SV=1 44 292 8.0E-06
sp|Q5ZJB4|IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus GN=CHUK PE=2 SV=1 141 331 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4685
MTDSTTPAPSAQSSSSSAYTYPSTFPNTTPSIPKPPSQPQSQTPSTPSPSPTGAFASFICHVAHLEKALQSAHSF
FDNPLHKPSSRTRLGHGTSFLVDRVELQPGRYAVIKTVRQSQHSPTQWRDVLLEIRVLLHKPIRYHPNIVRLLDI
GWDGSSEIASPFPALIQEYAEFGTLARIQGGGCLPLSFAVKQKLCYDVGRGLSILHGCGIVHGDLKHENVLVFAN
RYDTPAGQPYTAKVADFGGSVMDMTDQHSVPMNTFPYEAPEIGQKLSIEGVKKTDVFSYGMLIWRCMLDCQDVLS
AINFSLPPGPPSTQHRTLLNKLKTADHVLESAITSLSQHPTTRSLPSQSLNLIVGALLFTLRGDASLRALDRAQA
RLRGMTASASLDYVLIKDMANRGLADGQRRRTPGRHGIDVDGVGYALGRVAGDDYDAQNNLPGFRPDLPQPETAG
FLFEPLKLRRLLDWEQQQDMVAEFKAAAMVEKRAGTTTVAAGLEPWSAAFFLYQSFLSGFGVVVDGAEACRWLRS
AAAASEETASVDYLAGAWLVRAHRALGVVNPLTRGEQMDYLYWGLIRGHRHCSTDARAVMESEDDAGRRSVLEDR
MFEARYNHLSRTGGTGLPFFISRRLTRRWDTPEISVLDDLIRAELGEGYDSSLRQGLHPTEAIPIEPAPEQGHKL
DTIFVNNKGHGLLHLVATLGNVTILQHLHRTYKCNLNLSNQSHSDTPLTCACRAGNMACALYLVENGADANGTQF
GEESPLHCIVNFADADMDVIVGMLVAAGADMEKASNASRKDVRAVLADWEDSGSMRCSPLGRAVLYQSLYAVELL
LRHGADPWARPTDSKMVVMAPVELAAVLTLPDILQAMLSHADADSTPLFDECGMLRTAHSASLTPYDALSLQSRI
IRCGSLYKTNLMRTLRILRDRRLRLGLRADESSPGAQLCAEIELGNRDIVEALLDLGHHVNVHTNSSVRAIGYLA
AAHADSHSSIVMSPLVNESKDLSAVHVVAGCRSRDWNEYSQISERIVQLVLEMFPTAEALGGHHVHPSVGTPLTA
AVLAGNKSVVALLMESSFRHDVDRAVSVEYQLDGVSVRESLTPRELASKMAHDLTQRLTLSNPSSSAKDLNQLIT
TSEIMQQLASNNQDREAQVASSNLSKTIRAIKAQANSSHPQDPTASLPVDLSVVCEEKASGWREGVEMTEVMAHR
TFLKAFRSADGPFGDGITGAMDKAFNKRPAELRSS*
Coding >Ophun1|4685
ATGACAGACTCAACAACTCCAGCTCCCTCAGCCCAATCCTCCTCCTCCTCAGCCTACACCTACCCATCCACCTTT
CCCAACACCACTCCCTCCATCCCCAAACCCCCATCCCAACCCCAATCTCAAACACCATCCACACCATCCCCCTCC
CCAACTGGTGCCTTCGCCTCCTTCATCTGCCACGTCGCCCACCTCGAAAAAGCCCTCCAATCAGCACACTCCTTC
TTCGACAACCCCCTCCACAAGCCCTCTTCCCGAACCCGCCTCGGCCACGGAACCTCATTCCTCGTCGACCGCGTC
GAGCTCCAACCCGGTCGATACGCCGTCATCAAGACGGTGCGACAGAGTCAGCATAGCCCAACGCAGTGGCGCGAC
GTGCTCCTCGAGATACGCGTGCTGCTCCATAAGCCCATCCGCTATCATCCCAACATCGTCCGCCTCCTTGATATC
GGCTGGGATGGCTCCAGTGAGATTGCGTCGCCTTTCCCGGCTCTCATCCAGGAATACGCCGAGTTTGGAACGCTG
GCGAGGATTCAGGGGGGGGGATGTCTCCCTTTATCGTTTGCTGTGAAGCAGAAGCTCTGCTACGATGTTGGAAGG
GGCCTCTCCATCTTACACGGCTGTGGCATCGTCCACGGCGATCTCAAGCATGAAAACGTCCTCGTCTTCGCGAAC
CGTTACGATACACCGGCTGGACAGCCTTATACAGCAAAGGTGGCCGACTTTGGCGGCAGCGTCATGGACATGACG
GATCAACACAGCGTCCCCATGAACACATTCCCCTACGAAGCCCCCGAGATAGGCCAGAAGCTCTCCATTGAAGGC
GTCAAGAAGACCGACGTCTTCTCCTACGGAATGCTCATCTGGCGATGTATGCTCGACTGTCAAGACGTCCTCTCC
GCCATCAACTTCTCTCTCCCCCCCGGACCACCCAGCACCCAGCACCGCACCCTGCTAAACAAGCTCAAGACAGCA
GACCATGTCCTCGAATCCGCCATCACCAGCCTCAGCCAACACCCAACAACACGCTCCCTCCCCTCCCAAAGCCTC
AACCTCATCGTCGGCGCCCTCCTCTTCACCCTCAGAGGAGACGCCTCTCTCCGGGCCTTGGATCGTGCTCAGGCT
CGTCTAAGGGGCATGACGGCCTCGGCCTCACTCGATTACGTCCTCATCAAGGATATGGCGAATAGGGGACTGGCA
GACGGTCAGCGACGACGTACGCCGGGGAGACACGGGATCGACGTGGATGGCGTTGGATACGCTCTCGGCCGTGTA
GCAGGCGACGACTACGACGCTCAGAACAACCTCCCGGGCTTCCGACCAGATCTACCCCAACCGGAAACAGCGGGC
TTCTTATTCGAACCCCTGAAGCTCCGTCGGCTGCTGGACTGGGAGCAGCAGCAGGACATGGTAGCCGAGTTCAAG
GCCGCTGCCATGGTCGAGAAGAGAGCTGGAACGACGACGGTGGCGGCTGGGCTGGAGCCGTGGTCTGCCGCCTTC
TTCCTGTATCAGAGCTTCCTCAGCGGCTTTGGCGTCGTCGTCGATGGTGCTGAGGCCTGTCGTTGGCTGAGGTCT
GCTGCTGCGGCGAGCGAGGAGACGGCTTCGGTTGATTACCTGGCTGGGGCATGGCTCGTACGCGCTCACCGGGCT
CTCGGCGTGGTGAATCCCCTGACGAGAGGGGAGCAGATGGATTACTTGTACTGGGGTCTCATCAGGGGTCATCGT
CACTGCTCTACAGACGCGAGAGCCGTCATGGAGTCGGAGGATGATGCCGGTCGACGGTCCGTGTTAGAGGACCGA
ATGTTCGAGGCCCGGTATAACCATCTCTCCCGGACCGGAGGCACCGGCCTCCCGTTCTTTATATCCCGGAGGCTG
ACTCGCCGCTGGGACACGCCGGAAATCTCGGTTCTCGACGACCTCATCAGAGCCGAGCTGGGCGAAGGCTACGAC
TCCAGTCTCCGTCAGGGGCTCCATCCAACCGAAGCCATACCCATAGAACCAGCCCCGGAACAAGGCCACAAGCTG
GACACCATCTTCGTCAACAACAAGGGCCACGGCCTCCTCCACCTCGTCGCCACGCTGGGAAACGTCACCATTCTT
CAACACTTACACCGGACCTACAAGTGCAACCTCAACCTCAGCAACCAGTCTCACAGCGACACGCCCTTGACCTGT
GCCTGTCGAGCCGGAAACATGGCCTGTGCCCTCTACCTCGTCGAAAACGGAGCCGACGCCAACGGGACCCAGTTC
GGCGAAGAGTCTCCGCTGCACTGCATCGTCAACTTTGCTGACGCGGACATGGACGTCATCGTCGGCATGCTGGTC
GCCGCTGGGGCGGACATGGAGAAGGCGTCTAATGCTTCGAGAAAGGACGTTCGCGCCGTGCTGGCTGATTGGGAG
GATAGCGGCTCGATGAGGTGCTCTCCGCTGGGAAGAGCCGTCTTGTATCAGAGCTTGTACGCTGTTGAGCTGCTG
TTGAGACACGGGGCTGATCCTTGGGCTCGTCCAACGGACTCTAAGATGGTCGTCATGGCGCCTGTTGAACTGGCT
GCTGTTCTGACGCTGCCTGATATCTTACAGGCCATGCTCTCACACGCAGACGCAGACTCAACCCCCCTATTCGAC
GAGTGCGGCATGCTCCGAACCGCCCATTCAGCCTCCCTGACTCCTTACGACGCCCTCTCGCTACAAAGCCGCATC
ATCCGCTGCGGATCGCTGTACAAGACCAATCTCATGCGCACACTCCGCATCCTAAGAGACAGGAGGCTCCGTCTC
GGCCTCAGGGCAGATGAATCCTCGCCAGGAGCACAACTCTGCGCGGAAATCGAGCTGGGGAATCGGGATATCGTC
GAGGCGCTTCTTGATCTTGGGCACCATGTCAATGTTCATACAAACTCCAGCGTCCGGGCCATCGGTTATCTCGCC
GCCGCGCACGCAGATTCTCATTCAAGCATCGTCATGAGTCCCCTCGTCAACGAGAGTAAAGATCTATCTGCTGTT
CACGTCGTGGCTGGCTGTCGGTCAAGGGACTGGAATGAATACTCGCAGATTTCAGAGAGGATTGTGCAGCTCGTT
CTCGAAATGTTCCCCACGGCTGAGGCGTTGGGGGGTCATCATGTTCATCCTTCTGTTGGCACGCCCCTGACAGCC
GCCGTCCTCGCGGGGAATAAGAGCGTCGTGGCTCTGCTAATGGAATCTTCTTTCCGGCATGATGTTGATAGGGCT
GTCTCGGTTGAGTATCAGCTCGATGGTGTCTCTGTCAGAGAGTCCCTGACGCCGAGAGAGTTGGCTTCCAAAATG
GCACACGATCTAACCCAACGCCTAACCCTCTCCAACCCATCCAGCTCCGCCAAAGACCTCAACCAACTTATCACC
ACGTCGGAAATCATGCAGCAACTCGCTTCCAACAACCAAGACCGGGAAGCCCAGGTCGCAAGCAGCAATCTCAGC
AAGACCATCCGCGCCATCAAAGCCCAGGCCAACTCCTCCCACCCGCAGGATCCAACCGCCAGCCTCCCCGTCGAC
CTATCCGTCGTGTGCGAGGAAAAGGCCAGCGGGTGGCGTGAAGGCGTCGAGATGACAGAGGTCATGGCCCATAGG
ACTTTTCTCAAGGCGTTTCGTAGTGCGGATGGGCCATTTGGTGATGGTATTACTGGTGCTATGGATAAGGCGTTT
AACAAGAGGCCGGCCGAGCTGCGGAGCTCGTGA
Transcript >Ophun1|4685
ATGACAGACTCAACAACTCCAGCTCCCTCAGCCCAATCCTCCTCCTCCTCAGCCTACACCTACCCATCCACCTTT
CCCAACACCACTCCCTCCATCCCCAAACCCCCATCCCAACCCCAATCTCAAACACCATCCACACCATCCCCCTCC
CCAACTGGTGCCTTCGCCTCCTTCATCTGCCACGTCGCCCACCTCGAAAAAGCCCTCCAATCAGCACACTCCTTC
TTCGACAACCCCCTCCACAAGCCCTCTTCCCGAACCCGCCTCGGCCACGGAACCTCATTCCTCGTCGACCGCGTC
GAGCTCCAACCCGGTCGATACGCCGTCATCAAGACGGTGCGACAGAGTCAGCATAGCCCAACGCAGTGGCGCGAC
GTGCTCCTCGAGATACGCGTGCTGCTCCATAAGCCCATCCGCTATCATCCCAACATCGTCCGCCTCCTTGATATC
GGCTGGGATGGCTCCAGTGAGATTGCGTCGCCTTTCCCGGCTCTCATCCAGGAATACGCCGAGTTTGGAACGCTG
GCGAGGATTCAGGGGGGGGGATGTCTCCCTTTATCGTTTGCTGTGAAGCAGAAGCTCTGCTACGATGTTGGAAGG
GGCCTCTCCATCTTACACGGCTGTGGCATCGTCCACGGCGATCTCAAGCATGAAAACGTCCTCGTCTTCGCGAAC
CGTTACGATACACCGGCTGGACAGCCTTATACAGCAAAGGTGGCCGACTTTGGCGGCAGCGTCATGGACATGACG
GATCAACACAGCGTCCCCATGAACACATTCCCCTACGAAGCCCCCGAGATAGGCCAGAAGCTCTCCATTGAAGGC
GTCAAGAAGACCGACGTCTTCTCCTACGGAATGCTCATCTGGCGATGTATGCTCGACTGTCAAGACGTCCTCTCC
GCCATCAACTTCTCTCTCCCCCCCGGACCACCCAGCACCCAGCACCGCACCCTGCTAAACAAGCTCAAGACAGCA
GACCATGTCCTCGAATCCGCCATCACCAGCCTCAGCCAACACCCAACAACACGCTCCCTCCCCTCCCAAAGCCTC
AACCTCATCGTCGGCGCCCTCCTCTTCACCCTCAGAGGAGACGCCTCTCTCCGGGCCTTGGATCGTGCTCAGGCT
CGTCTAAGGGGCATGACGGCCTCGGCCTCACTCGATTACGTCCTCATCAAGGATATGGCGAATAGGGGACTGGCA
GACGGTCAGCGACGACGTACGCCGGGGAGACACGGGATCGACGTGGATGGCGTTGGATACGCTCTCGGCCGTGTA
GCAGGCGACGACTACGACGCTCAGAACAACCTCCCGGGCTTCCGACCAGATCTACCCCAACCGGAAACAGCGGGC
TTCTTATTCGAACCCCTGAAGCTCCGTCGGCTGCTGGACTGGGAGCAGCAGCAGGACATGGTAGCCGAGTTCAAG
GCCGCTGCCATGGTCGAGAAGAGAGCTGGAACGACGACGGTGGCGGCTGGGCTGGAGCCGTGGTCTGCCGCCTTC
TTCCTGTATCAGAGCTTCCTCAGCGGCTTTGGCGTCGTCGTCGATGGTGCTGAGGCCTGTCGTTGGCTGAGGTCT
GCTGCTGCGGCGAGCGAGGAGACGGCTTCGGTTGATTACCTGGCTGGGGCATGGCTCGTACGCGCTCACCGGGCT
CTCGGCGTGGTGAATCCCCTGACGAGAGGGGAGCAGATGGATTACTTGTACTGGGGTCTCATCAGGGGTCATCGT
CACTGCTCTACAGACGCGAGAGCCGTCATGGAGTCGGAGGATGATGCCGGTCGACGGTCCGTGTTAGAGGACCGA
ATGTTCGAGGCCCGGTATAACCATCTCTCCCGGACCGGAGGCACCGGCCTCCCGTTCTTTATATCCCGGAGGCTG
ACTCGCCGCTGGGACACGCCGGAAATCTCGGTTCTCGACGACCTCATCAGAGCCGAGCTGGGCGAAGGCTACGAC
TCCAGTCTCCGTCAGGGGCTCCATCCAACCGAAGCCATACCCATAGAACCAGCCCCGGAACAAGGCCACAAGCTG
GACACCATCTTCGTCAACAACAAGGGCCACGGCCTCCTCCACCTCGTCGCCACGCTGGGAAACGTCACCATTCTT
CAACACTTACACCGGACCTACAAGTGCAACCTCAACCTCAGCAACCAGTCTCACAGCGACACGCCCTTGACCTGT
GCCTGTCGAGCCGGAAACATGGCCTGTGCCCTCTACCTCGTCGAAAACGGAGCCGACGCCAACGGGACCCAGTTC
GGCGAAGAGTCTCCGCTGCACTGCATCGTCAACTTTGCTGACGCGGACATGGACGTCATCGTCGGCATGCTGGTC
GCCGCTGGGGCGGACATGGAGAAGGCGTCTAATGCTTCGAGAAAGGACGTTCGCGCCGTGCTGGCTGATTGGGAG
GATAGCGGCTCGATGAGGTGCTCTCCGCTGGGAAGAGCCGTCTTGTATCAGAGCTTGTACGCTGTTGAGCTGCTG
TTGAGACACGGGGCTGATCCTTGGGCTCGTCCAACGGACTCTAAGATGGTCGTCATGGCGCCTGTTGAACTGGCT
GCTGTTCTGACGCTGCCTGATATCTTACAGGCCATGCTCTCACACGCAGACGCAGACTCAACCCCCCTATTCGAC
GAGTGCGGCATGCTCCGAACCGCCCATTCAGCCTCCCTGACTCCTTACGACGCCCTCTCGCTACAAAGCCGCATC
ATCCGCTGCGGATCGCTGTACAAGACCAATCTCATGCGCACACTCCGCATCCTAAGAGACAGGAGGCTCCGTCTC
GGCCTCAGGGCAGATGAATCCTCGCCAGGAGCACAACTCTGCGCGGAAATCGAGCTGGGGAATCGGGATATCGTC
GAGGCGCTTCTTGATCTTGGGCACCATGTCAATGTTCATACAAACTCCAGCGTCCGGGCCATCGGTTATCTCGCC
GCCGCGCACGCAGATTCTCATTCAAGCATCGTCATGAGTCCCCTCGTCAACGAGAGTAAAGATCTATCTGCTGTT
CACGTCGTGGCTGGCTGTCGGTCAAGGGACTGGAATGAATACTCGCAGATTTCAGAGAGGATTGTGCAGCTCGTT
CTCGAAATGTTCCCCACGGCTGAGGCGTTGGGGGGTCATCATGTTCATCCTTCTGTTGGCACGCCCCTGACAGCC
GCCGTCCTCGCGGGGAATAAGAGCGTCGTGGCTCTGCTAATGGAATCTTCTTTCCGGCATGATGTTGATAGGGCT
GTCTCGGTTGAGTATCAGCTCGATGGTGTCTCTGTCAGAGAGTCCCTGACGCCGAGAGAGTTGGCTTCCAAAATG
GCACACGATCTAACCCAACGCCTAACCCTCTCCAACCCATCCAGCTCCGCCAAAGACCTCAACCAACTTATCACC
ACGTCGGAAATCATGCAGCAACTCGCTTCCAACAACCAAGACCGGGAAGCCCAGGTCGCAAGCAGCAATCTCAGC
AAGACCATCCGCGCCATCAAAGCCCAGGCCAACTCCTCCCACCCGCAGGATCCAACCGCCAGCCTCCCCGTCGAC
CTATCCGTCGTGTGCGAGGAAAAGGCCAGCGGGTGGCGTGAAGGCGTCGAGATGACAGAGGTCATGGCCCATAGG
ACTTTTCTCAAGGCGTTTCGTAGTGCGGATGGGCCATTTGGTGATGGTATTACTGGTGCTATGGATAAGGCGTTT
AACAAGAGGCCGGCCGAGCTGCGGAGCTCGTGA
Gene >Ophun1|4685
ATGACAGACTCAACAACTCCAGCTCCCTCAGCCCAATCCTCCTCCTCCTCAGCCTACACCTACCCATCCACCTTT
CCCAACACCACTCCCTCCATCCCCAAACCCCCATCCCAACCCCAATCTCAAACACCATCCACACCATCCCCCTCC
CCAACTGGTGCCTTCGCCTCCTTCATCTGCCACGTCGCCCACCTCGAAAAAGCCCTCCAATCAGCACACTCCTTC
TTCGACAACCCCCTCCACAAGCCCTCTTCCCGAACCCGCCTCGGCCACGGAACCTCATTCCTCGTCGACCGCGTC
GAGCTCCAACCCGGTCGATACGCCGTCATCAAGACGGTGCGACAGAGTCAGCATAGCCCAACGCAGTGGCGCGAC
GTGCTCCTCGAGATACGCGTGCTGCTCCATAAGCCCATCCGCTATCATCCCAACATCGTCCGCCTCCTTGATATC
GGCTGGGATGGCTCCAGTGAGATTGCGTCGCCTTTCCCGGCTCTCATCCAGGAATACGCCGAGTTTGGAACGCTG
GCGAGGATTCAGGGGGGGGGATGTCTCCCTTTATCGTTTGCTGTGAAGCAGAAGCTCTGCTACGATGTTGGAAGG
GGCCTCTCCATCTTACACGGCTGTGGCATCGTCCACGGCGATCTCAAGCATGAAAACGTCCTCGTCTTCGCGAAC
CGTTACGATACACCGGCTGGACAGCCTTATACAGCAAAGGTGGCCGACTTTGGCGGCAGCGTCATGGACATGACG
GATCAACACAGCGTCCCCATGAACACATTCCCCTACGAAGCCCCCGAGATAGGCCAGAAGCTCTCCATTGAAGGC
GTCAAGAAGACCGACGTCTTCTCCTACGGAATGCTCATCTGGCGATGTATGCTCGACTGTCAAGACGTCCTCTCC
GCCATCAACTTCTCTCTCCCCCCCGGACCACCCAGCACCCAGCACCGCACCCTGCTAAACAAGCTCAAGACAGCA
GACCATGTCCTCGAATCCGCCATCACCAGCCTCAGCCAACACCCAACAACACGCTCCCTCCCCTCCCAAAGCCTC
AACCTCATCGTCGGCGCCCTCCTCTTCACCCTCAGAGGAGACGCCTCTCTCCGGGCCTTGGATCGTGCTCAGGCT
CGTCTAAGGGGCATGACGGCCTCGGCCTCACTCGATTACGTCCTCATCAAGGATATGGCGAATAGGGGACTGGCA
GACGGTCAGCGACGACGTACGCCGGGGAGACACGGGATCGACGTGGATGGCGTTGGATACGCTCTCGGCCGTGTA
GCAGGCGACGACTACGACGCTCAGAACAACCTCCCGGGCTTCCGACCAGATCTACCCCAACCGGAAACAGCGGGC
TTCTTATTCGAACCCCTGAAGCTCCGTCGGCTGCTGGACTGGGAGCAGCAGCAGGACATGGTAGCCGAGTTCAAG
GCCGCTGCCATGGTCGAGAAGAGAGCTGGAACGACGACGGTGGCGGCTGGGCTGGAGCCGTGGTCTGCCGCCTTC
TTCCTGTATCAGAGCTTCCTCAGCGGCTTTGGCGTCGTCGTCGATGGTGCTGAGGCCTGTCGTTGGCTGAGGTCT
GCTGCTGCGGCGAGCGAGGAGACGGCTTCGGTTGATTACCTGGCTGGGGCATGGCTCGTACGCGCTCACCGGGCT
CTCGGCGTGGTGAATCCCCTGACGAGAGGGGAGCAGATGGATTACTTGTACTGGGGTCTCATCAGGGGTCATCGT
CACTGCTCTACAGACGCGAGAGCCGTCATGGAGTCGGAGGATGATGCCGGTCGACGGTCCGTGTTAGAGGACCGA
ATGTTCGAGGCCCGGTATAACCATCTCTCCCGGACCGGAGGCACCGGCCTCCCGTTCTTTATATCCCGGAGGCTG
ACTCGCCGCTGGGACACGCCGGAAATCTCGGTTCTCGACGACCTCATCAGAGCCGAGCTGGGCGAAGGCTACGAC
TCCAGTCTCCGTCAGGGGCTCCATCCAACCGAAGCCATACCCATAGAACCAGCCCCGGAACAAGGCCACAAGCTG
GACACCATCTTCGTCAACAACAAGGGCCACGGCCTCCTCCACCTCGTCGCCACGCTGGGAAACGTCACCATTCTT
CAACACTTACACCGGACCTACAAGTGCAACCTCAACCTCAGCAACCAGTCTCACAGCGACACGCCCTTGACCTGT
GCCTGTCGAGCCGGAAACATGGCCTGTGCCCTCTACCTCGTCGAAAACGGAGCCGACGCCAACGGGACCCAGTTC
GGCGAAGAGTCTCCGCTGCACTGCATCGTCAACTTTGCTGACGCGGACATGGACGTCATCGTCGGCATGCTGGTC
GCCGCTGGGGCGGACATGGAGAAGGCGTCTAATGCTTCGAGAAAGGACGTTCGCGCCGTGCTGGCTGATTGGGAG
GATAGCGGCTCGATGAGGTGCTCTCCGCTGGGAAGAGCCGTCTTGTATCAGAGCTTGTACGCTGTTGAGCTGCTG
TTGAGACACGGGGCTGATCCTTGGGCTCGTCCAACGGACTCTAAGATGGTCGTCATGGCGCCTGTTGAACTGGCT
GCTGTTCTGACGCTGCCTGATATCTTACAGGCCATGCTCTCACACGCAGACGCAGACTCAACCCCCCTATTCGAC
GAGTGCGGCATGCTCCGAACCGCCCATTCAGCCTCCCTGACTCCTTACGACGCCCTCTCGCTACAAAGCCGCATC
ATCCGCTGCGGATCGCTGTACAAGACCAATCTCATGCGCACACTCCGCATCCTAAGAGACAGGAGGCTCCGTCTC
GGCCTCAGGGCAGATGAATCCTCGCCAGGAGCACAACTCTGCGCGGAAATCGAGCTGGGGAATCGGGATATCGTC
GAGGCGCTTCTTGATCTTGGGCACCATGTCAATGGTTCGGCTTGTTCGCGGCCTGTTCGTGCTGCGGTGGTGGCC
AACCATGAAGACATCTTCTTTGAGCTGGTGAGAAGGGGAGCTTCGCTGGCTTCAAGGGGGGAACTTTTGGCTGCT
TCTGCTGCACGTCCGCGTCATACCCCTCGAGGAACGCGTATCGTCGAGCACCTCCTCAGCCAACCCCTATCCTCA
GAGCCAACGACAACCCCCTGTGCGCTATCCCTCGCCATTCGAAACGGCTATTTCGAAGTAGCGGATCTATTGACT
TCAAGCACGCCAGCTGAGAGTCTCAATGGGTTTCATGTTTGGGTTGAAGGCGGTGATTCAGAGTCTGTGCTGGGC
TCTCTGCTTGCAGTTCATACAAACTCCAGCGTCCGGGCCATCGGTTATCTCGCCGCCGCGCACGCAGATTCTCAT
TCAAGCATCGTCATGAGTCCCCTCGTCAACGAGAGTAAAGATCTATCTGCTGTTCACGTCGTGGCTGGCTGTCGG
TCAAGGGACTGGAATGAATACTCGCAGATTTCAGAGAGGATTGTGCAGCTCGTTCTCGAAATGTTCCCCACGGCT
GAGGCGTTGGGGGGTCATCATGTTCATCCTTCTGTTGGCACGCCCCTGACAGCCGCCGTCCTCGCGGGGAATAAG
AGCGTCGTGGCTCTGCTAATGGAATCTTCTTTCCGGCATGATGTTGATAGGGCTGTCTCGGTTGAGTATCAGCTC
GATGGTGTCTCTGTCAGAGAGTCCCTGACGCCGAGAGAGTTGGCTTCCAAAATGGCACACGATCTAACCCAACGC
CTAACCCTCTCCAACCCATCCAGCTCCGCCAAAGACCTCAACCAACTTATCACCACGTCGGAAATCATGCAGCAA
CTCGCTTCCAACAACCAAGACCGGGAAGCCCAGGTCGCAAGCAGCAATCTCAGCAAGACCATCCGCGCCATCAAA
GCCCAGGCCAACTCCTCCCACCCGCAGGATCCAACCGCCAGCCTCCCCGTCGACCTATCCGTCGTGTGCGAGGAA
AAGGCCAGCGGGTGGCGTGAAGGCGTCGAGATGACAGAGGTCATGGCCCATAGGACTTTTCTCAAGGCGTTTCGT
AGTGCGGATGGGCCATTTGGTGATGGTATTACTGGTGCTATGGATAAGGCGTTTAACAAGAGGCCGGCCGAGCTG
CGGAGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail