Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4680
Gene name
LocationContig_437:14406..15901
Strand-
Gene length (bp)1495
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05007 Mannosyl_trans Mannosyltransferase (PIG-M) 3.9E-78 155 428
PF06728 PIG-U GPI transamidase subunit PIG-U 1.3E-09 40 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I073|GPI14_GIBZE GPI mannosyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI14 PE=3 SV=1 31 446 0.0E+00
sp|Q2TXB8|GPI14_ASPOR GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi14 PE=3 SV=2 30 435 2.0E-152
sp|Q7S4Z3|GPI14_NEUCR GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gim-1 PE=3 SV=1 35 433 7.0E-150
sp|Q5B7W0|GPI14_EMENI GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpi14 PE=3 SV=1 43 446 2.0E-148
sp|Q4WAH2|GPI14_ASPFU GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi14 PE=3 SV=1 43 430 5.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I073|GPI14_GIBZE GPI mannosyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI14 PE=3 SV=1 31 446 0.0E+00
sp|Q2TXB8|GPI14_ASPOR GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi14 PE=3 SV=2 30 435 2.0E-152
sp|Q7S4Z3|GPI14_NEUCR GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gim-1 PE=3 SV=1 35 433 7.0E-150
sp|Q5B7W0|GPI14_EMENI GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpi14 PE=3 SV=1 43 446 2.0E-148
sp|Q4WAH2|GPI14_ASPFU GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi14 PE=3 SV=1 43 430 5.0E-144
sp|Q9P6R5|GPI14_SCHPO GPI mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi14 PE=3 SV=2 43 428 4.0E-115
sp|Q6BHI9|GPI14_DEBHA GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI14 PE=3 SV=2 31 430 9.0E-103
sp|Q5AMR5|GPI14_CANAL GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI14 PE=3 SV=1 40 422 1.0E-100
sp|Q6CRE7|GPI14_KLULA GPI mannosyltransferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI14 PE=3 SV=1 44 445 5.0E-93
sp|Q6FXQ5|GPI14_CANGA GPI mannosyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI14 PE=3 SV=1 40 430 2.0E-92
sp|P47088|GPI14_YEAST GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI14 PE=1 SV=2 32 430 2.0E-89
sp|Q75C82|GPI14_ASHGO GPI mannosyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI14 PE=3 SV=1 32 446 4.0E-88
sp|Q66IJ4|PIGM_XENTR GPI mannosyltransferase 1 OS=Xenopus tropicalis GN=pigm PE=2 SV=1 31 430 4.0E-80
sp|Q54IA4|PIGM_DICDI GPI mannosyltransferase 1 OS=Dictyostelium discoideum GN=pigm PE=3 SV=1 36 430 4.0E-78
sp|Q500W7|PIGM_ARATH GPI mannosyltransferase 1 OS=Arabidopsis thaliana GN=PIGM PE=2 SV=1 26 428 8.0E-74
sp|Q9EQY6|PIGM_RAT GPI mannosyltransferase 1 OS=Rattus norvegicus GN=Pigm PE=2 SV=1 36 429 2.0E-73
sp|Q5EA10|PIGM_BOVIN GPI mannosyltransferase 1 OS=Bos taurus GN=PIGM PE=2 SV=1 26 429 1.0E-72
sp|Q4R4E1|PIGM_MACFA GPI mannosyltransferase 1 OS=Macaca fascicularis GN=PIGM PE=2 SV=1 28 429 1.0E-71
sp|Q8C2R7|PIGM_MOUSE GPI mannosyltransferase 1 OS=Mus musculus GN=Pigm PE=2 SV=2 36 429 2.0E-71
sp|Q5RAH7|PIGM_PONAB GPI mannosyltransferase 1 OS=Pongo abelii GN=PIGM PE=2 SV=1 36 429 2.0E-71
sp|Q9H3S5|PIGM_HUMAN GPI mannosyltransferase 1 OS=Homo sapiens GN=PIGM PE=1 SV=1 36 429 2.0E-71
sp|Q5F380|PIGM_CHICK GPI mannosyltransferase 1 OS=Gallus gallus GN=PIGM PE=2 SV=2 44 433 3.0E-61
sp|Q7T310|PIGM_DANRE GPI mannosyltransferase 1 OS=Danio rerio GN=pigm PE=2 SV=1 51 428 8.0E-58
sp|Q9BPQ5|PIGM_TRYB2 GPI mannosyltransferase 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIGM PE=2 SV=2 48 418 5.0E-51
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0004376 glycolipid mannosyltransferase activity Yes
GO:0016021 integral component of membrane Yes
GO:0051751 alpha-1,4-mannosyltransferase activity Yes
GO:0006497 protein lipidation No
GO:0000030 mannosyltransferase activity No
GO:0016740 transferase activity No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006643 membrane lipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0031224 intrinsic component of membrane No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0016757 glycosyltransferase activity No
GO:0016758 hexosyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0008150 biological_process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0005575 cellular_component No
GO:0006793 phosphorus metabolic process No
GO:0036211 protein modification process No
GO:0006664 glycolipid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043412 macromolecule modification No
GO:0019538 protein metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 96 118 22
2 154 176 22
3 183 205 22
4 240 262 22
5 307 326 19
6 352 369 17
7 374 391 17
8 406 428 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4680
MTIYIQVFFFLSDTAPTEIYLIIYLDRDKSLEETPLFLTATILRLSLLAYGTWQDTHSTVKYTDIDYHVFTDAAH
ALHAAHPSGPYARETYRYTPLLAWLLLPTTAVFAAGKLIFIAADLVAGWLAVRLLASRVADGRGYAFAALWLWNP
MVAAISSRGSCEGLLAVLTLALLWAVEMRRVGLAGGLLGLAVHFKIYPFIYAPAIIWWMDDDNMGRHLRPALSNP
SSSARLARFFSPERIRLAIVSIATFMGLNTLMYSLYGTPFLIHTYLHHVRRIDHRHNFSPYNILLYQTSADPPSG
PSLRVESLAFVPQLLLSCVLIPLVVAKKDLAASMMAQTFAFVTFNKVCTSQYFLWYMIFLPLVLPGSSFLRKPAL
GLAALGLWIASQAAWLHQAYQLEFLGRSTFFPGLWLASLAFFLVNCWILAIIIADGAQTGPRRAAHKAHVE*
Coding >Ophun1|4680
ATGACCATATATATTCAGGTTTTTTTTTTTTTAAGTGATACGGCGCCCACCGAGATCTACCTTATCATATACCTC
GACAGGGACAAATCTTTAGAAGAGACACCCCTCTTCCTAACCGCCACGATCCTCCGCCTCAGCCTCCTCGCCTAC
GGCACCTGGCAAGACACGCACAGCACCGTCAAATACACCGACATAGACTACCACGTCTTCACCGACGCCGCCCAC
GCCCTCCACGCCGCCCACCCCTCCGGCCCCTACGCCCGCGAAACCTACCGCTACACCCCGCTGCTAGCCTGGCTC
CTCCTCCCGACGACGGCCGTCTTCGCCGCCGGCAAGCTCATCTTCATCGCCGCCGACCTCGTCGCTGGCTGGCTT
GCCGTGCGCCTCCTGGCGTCGAGGGTCGCCGACGGGCGGGGCTATGCTTTCGCCGCGCTTTGGCTTTGGAACCCG
ATGGTTGCGGCTATTAGTTCGAGGGGCAGCTGTGAGGGTCTGTTGGCGGTGTTGACGTTGGCGTTGTTGTGGGCT
GTTGAGATGAGGCGGGTGGGATTGGCTGGGGGGTTGCTGGGGTTGGCTGTTCACTTCAAGATTTATCCCTTCATT
TATGCTCCCGCCATCATCTGGTGGATGGACGACGATAACATGGGCCGCCACCTTCGACCTGCCCTCTCGAACCCA
TCGTCGTCAGCACGCCTCGCCCGCTTCTTCTCCCCGGAGAGGATACGCCTCGCCATCGTCAGCATCGCCACCTTC
ATGGGCCTCAACACGCTCATGTACTCCCTATACGGCACCCCCTTTCTCATCCACACCTACCTCCATCACGTAAGG
CGCATCGACCACCGCCACAACTTCTCCCCCTACAACATACTCCTCTACCAGACCTCGGCCGACCCCCCCTCCGGT
CCCTCCCTGCGCGTCGAGTCGCTCGCCTTCGTCCCCCAGCTCCTCCTCTCGTGCGTCCTCATCCCCCTGGTCGTG
GCCAAGAAGGATCTTGCCGCCTCCATGATGGCCCAGACTTTTGCCTTTGTCACCTTCAACAAGGTCTGCACGTCT
CAGTATTTCCTTTGGTACATGATCTTTCTACCCCTCGTTCTCCCCGGCTCGTCGTTTCTCCGCAAGCCTGCCCTC
GGCCTGGCCGCTCTCGGTCTGTGGATAGCCTCTCAGGCCGCCTGGCTCCATCAAGCCTACCAGCTCGAGTTCCTC
GGCCGCAGCACCTTTTTCCCGGGCTTGTGGCTCGCCTCACTCGCCTTCTTCCTCGTCAACTGCTGGATCCTAGCC
ATAATCATCGCCGACGGCGCCCAGACGGGTCCACGCCGCGCCGCTCACAAGGCCCATGTCGAGTAG
Transcript >Ophun1|4680
ATGACCATATATATTCAGGTTTTTTTTTTTTTAAGTGATACGGCGCCCACCGAGATCTACCTTATCATATACCTC
GACAGGGACAAATCTTTAGAAGAGACACCCCTCTTCCTAACCGCCACGATCCTCCGCCTCAGCCTCCTCGCCTAC
GGCACCTGGCAAGACACGCACAGCACCGTCAAATACACCGACATAGACTACCACGTCTTCACCGACGCCGCCCAC
GCCCTCCACGCCGCCCACCCCTCCGGCCCCTACGCCCGCGAAACCTACCGCTACACCCCGCTGCTAGCCTGGCTC
CTCCTCCCGACGACGGCCGTCTTCGCCGCCGGCAAGCTCATCTTCATCGCCGCCGACCTCGTCGCTGGCTGGCTT
GCCGTGCGCCTCCTGGCGTCGAGGGTCGCCGACGGGCGGGGCTATGCTTTCGCCGCGCTTTGGCTTTGGAACCCG
ATGGTTGCGGCTATTAGTTCGAGGGGCAGCTGTGAGGGTCTGTTGGCGGTGTTGACGTTGGCGTTGTTGTGGGCT
GTTGAGATGAGGCGGGTGGGATTGGCTGGGGGGTTGCTGGGGTTGGCTGTTCACTTCAAGATTTATCCCTTCATT
TATGCTCCCGCCATCATCTGGTGGATGGACGACGATAACATGGGCCGCCACCTTCGACCTGCCCTCTCGAACCCA
TCGTCGTCAGCACGCCTCGCCCGCTTCTTCTCCCCGGAGAGGATACGCCTCGCCATCGTCAGCATCGCCACCTTC
ATGGGCCTCAACACGCTCATGTACTCCCTATACGGCACCCCCTTTCTCATCCACACCTACCTCCATCACGTAAGG
CGCATCGACCACCGCCACAACTTCTCCCCCTACAACATACTCCTCTACCAGACCTCGGCCGACCCCCCCTCCGGT
CCCTCCCTGCGCGTCGAGTCGCTCGCCTTCGTCCCCCAGCTCCTCCTCTCGTGCGTCCTCATCCCCCTGGTCGTG
GCCAAGAAGGATCTTGCCGCCTCCATGATGGCCCAGACTTTTGCCTTTGTCACCTTCAACAAGGTCTGCACGTCT
CAGTATTTCCTTTGGTACATGATCTTTCTACCCCTCGTTCTCCCCGGCTCGTCGTTTCTCCGCAAGCCTGCCCTC
GGCCTGGCCGCTCTCGGTCTGTGGATAGCCTCTCAGGCCGCCTGGCTCCATCAAGCCTACCAGCTCGAGTTCCTC
GGCCGCAGCACCTTTTTCCCGGGCTTGTGGCTCGCCTCACTCGCCTTCTTCCTCGTCAACTGCTGGATCCTAGCC
ATAATCATCGCCGACGGCGCCCAGACGGGTCCACGCCGCGCCGCTCACAAGGCCCATGTCGAGTAG
Gene >Ophun1|4680
ATGACCATATATATTCAGGTTTTTTTTTTTTTAAGTGATACGGCGCCCACCGAGATCTACCTTATCATATACCTC
GACAGGGACAAATCTTTAGAAGAGACACCCCTCTTCCTAACCGCCACGATCCTCCGCCTCAGCCTCCTCGCCTAC
GGCACCTGGCAAGACACGCACAGCACCGTCAAATACACCGACATAGACTACCACGTCTTCACCGACGCCGCCCAC
GCCCTCCACGCCGCCCACCCCTCCGGCCCCTACGCCCGCGAAACCTACCGCTACACCCCGCTGCTAGCCTGGCTC
CTCCTCCCGACGACGGCCGTCTTCGCCGCCGGCAAGCTCATCTTCATCGCCGCCGACCTCGTCGCTGGCTGGCTT
GCCGTGCGCCTCCTGGCGTCGAGGGTCGCCGACGGGCGGGGCTATGCTTTCGCCGCGCTTTGGCTTTGGAACCCG
ATGGTTGCGGCTATTAGTTCGAGGGGCAGCTGTGAGGGTCTGTTGGCGGTGTTGACGTTGGCGTTGTTGTGGGCT
GTTGAGATGAGGCGGGTGGGATTGGCTGGGGGGTTGCTGGGGTTGGCTGTTCACTTCAAGATTTATCCCTTCATT
TATGCTCCCGCCATCATCTGGTGGATGGACGACGATAACATGGGCCGCCACCTTCGACCTGCCCTCTCGAACCCA
TCGTCGTCAGCACGCCTCGCCCGCTTCTTCTCCCCGGAGAGGATACGCCTCGCCATCGTCAGCATCGCCACCTTC
ATGGGCCTCAACACGCTCATGTACTCCCTGTCCGTCACCTCCCTCCCTCCCCCCCAAAATACTCTCAGCTGACAG
CCTCCCTCCCCAGATACGGCACCCCCTTTCTCATCCACACCTACCTCCATCACGTAAGGCGCATCGACCACCGCC
ACAACTTCTCCCCCTACAACATACTCCTCTACCAGACCTCGGCCGACCCCCCCTCCGGTCCCTCCCTGCGCGTCG
AGTCGCTCGCCTTCGTCCCCCAGCTCCTCCTCTCGTGCGTCCTCATCCCCCTGGTCGTGGCCAAGAAGGATCTTG
CCGCCTCCATGATGGCCCAGACTTTTGCCTTTGTCACCTTCAACAAGGTCTGCACGTCTCAGGTAGGCCAGCCCG
CGCTCGTCTCGTCTCTCGCCCGCGGGCCTTTATCTTGCAGACTACATGCTTACGTCTTCTCCCTTGTCTCCTTTC
CCACCAGTATTTCCTTTGGTACATGATCTTTCTACCCCTCGTTCTCCCCGGCTCGTCGTTTCTCCGCAAGCCTGC
CCTCGGCCTGGCCGCTCTCGGTCTGTGGATAGCCTCTCAGGCCGCCTGGCTCCATCAAGCCTACCAGCTCGAGTT
CCTCGGCCGCAGCACCTTTTTCCCGGGCTTGTGGCTCGCCTCACTCGCCTTCTTCCTCGTCAACTGCTGGATCCT
AGCCATAATCATCGCCGACGGCGCCCAGACGGGTCCACGCCGCGCCGCTCACAAGGCCCATGTCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail