Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4670
Gene name
LocationContig_436:7878..10715
Strand-
Gene length (bp)2837
Transcript length (bp)2583
Coding sequence length (bp)2583
Protein length (aa) 861

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain 7.2E-58 465 685
PF04675 DNA_ligase_A_N DNA ligase N terminus 8.3E-44 208 399
PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region 3.5E-26 710 825
PF09414 RNA_ligase RNA ligase 2.5E-06 485 685

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P12000|DNLI1_SCHPO DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc17 PE=3 SV=1 209 843 0.0E+00
sp|P51892|DNLI1_XENLA DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2 SV=1 136 848 0.0E+00
sp|P04819|DNLI1_YEAST DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC9 PE=1 SV=2 207 846 0.0E+00
sp|P18858|DNLI1_HUMAN DNA ligase 1 OS=Homo sapiens GN=LIG1 PE=1 SV=1 192 846 0.0E+00
sp|P37913|DNLI1_MOUSE DNA ligase 1 OS=Mus musculus GN=Lig1 PE=1 SV=2 191 859 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P12000|DNLI1_SCHPO DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc17 PE=3 SV=1 209 843 0.0E+00
sp|P51892|DNLI1_XENLA DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2 SV=1 136 848 0.0E+00
sp|P04819|DNLI1_YEAST DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC9 PE=1 SV=2 207 846 0.0E+00
sp|P18858|DNLI1_HUMAN DNA ligase 1 OS=Homo sapiens GN=LIG1 PE=1 SV=1 192 846 0.0E+00
sp|P37913|DNLI1_MOUSE DNA ligase 1 OS=Mus musculus GN=Lig1 PE=1 SV=2 191 859 0.0E+00
sp|Q9JHY8|DNLI1_RAT DNA ligase 1 OS=Rattus norvegicus GN=Lig1 PE=1 SV=1 191 859 0.0E+00
sp|Q9W1H4|DNLI1_DROME DNA ligase 1 OS=Drosophila melanogaster GN=DNA-ligI PE=1 SV=2 59 859 0.0E+00
sp|Q42572|DNLI1_ARATH DNA ligase 1 OS=Arabidopsis thaliana GN=LIG1 PE=2 SV=2 108 857 0.0E+00
sp|Q869E1|DNLI1_DICDI DNA ligase 1 OS=Dictyostelium discoideum GN=lig1 PE=3 SV=1 186 844 0.0E+00
sp|Q27474|DNLI1_CAEEL DNA ligase 1 OS=Caenorhabditis elegans GN=lig-1 PE=3 SV=2 200 855 0.0E+00
sp|Q9C1W9|DNLI3_SCHPO DNA ligase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adl1 PE=3 SV=1 209 843 4.0E-131
sp|A1RTK4|DNLI_PYRIL DNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=lig PE=3 SV=1 209 847 2.0E-102
sp|A3MS62|DNLI_PYRCJ DNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=lig PE=3 SV=1 209 846 6.0E-102
sp|Q6L195|DNLI_PICTO DNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=lig PE=3 SV=2 209 846 7.0E-102
sp|B1YA52|DNLI_PYRNV DNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=lig PE=3 SV=1 209 847 8.0E-99
sp|A8MDU6|DNLI_CALMQ DNA ligase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=lig PE=3 SV=1 209 846 1.0E-98
sp|O93723|DNLI_PYRAE DNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=lig PE=3 SV=2 209 846 2.0E-98
sp|A1RY72|DNLI2_THEPD DNA ligase 2 OS=Thermofilum pendens (strain Hrk 5) GN=lig2 PE=3 SV=1 203 847 2.0E-97
sp|A4WH24|DNLI_PYRAR DNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=lig PE=3 SV=1 209 847 4.0E-97
sp|Q980T8|DNLI_SULSO DNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lig PE=1 SV=1 209 856 6.0E-97
sp|A9A3K1|DNLI_NITMS DNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=lig PE=3 SV=1 209 851 4.0E-96
sp|Q02093|DNLI_ACIAM DNA ligase OS=Acidianus ambivalens GN=lig PE=3 SV=1 209 843 2.0E-95
sp|A3DP49|DNLI_STAMF DNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=lig PE=1 SV=2 207 843 7.0E-95
sp|D2CJS7|DNLI_SULZI DNA ligase OS=Sulfophobococcus zilligii GN=lig PE=1 SV=1 207 843 9.0E-95
sp|Q9P9K9|DNLI_SULSH DNA ligase OS=Sulfolobus shibatae GN=lig PE=1 SV=1 209 843 3.0E-94
sp|C3NF77|DNLI_SULIN DNA ligase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=lig PE=3 SV=1 209 843 8.0E-94
sp|C3N834|DNLI_SULIY DNA ligase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=lig PE=3 SV=1 209 843 2.0E-93
sp|C3MYD2|DNLI_SULIM DNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=lig PE=3 SV=1 209 843 2.0E-93
sp|C3MJ14|DNLI_SULIL DNA ligase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=lig PE=3 SV=1 209 843 2.0E-93
sp|C4KIZ2|DNLI_SULIK DNA ligase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=lig PE=3 SV=1 209 843 2.0E-93
sp|C3MZR1|DNLI_SULIA DNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=lig PE=3 SV=1 209 843 2.0E-93
sp|Q976G4|DNLI_SULTO DNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=lig PE=3 SV=1 209 841 3.0E-93
sp|Q4JAM1|DNLI_SULAC DNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lig PE=3 SV=1 209 843 7.0E-92
sp|Q9YD18|DNLI_AERPE DNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=lig PE=1 SV=2 250 843 2.0E-91
sp|A0RWD6|DNLI_CENSY DNA ligase OS=Cenarchaeum symbiosum (strain A) GN=lig PE=3 SV=2 209 854 2.0E-90
sp|A4YD25|DNLI_METS5 DNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=lig PE=3 SV=1 209 843 4.0E-90
sp|Q9HJ26|DNLI_THEAC DNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=lig PE=3 SV=1 209 844 5.0E-89
sp|B1L3V2|DNLI2_KORCO DNA ligase 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=lig2 PE=3 SV=1 209 843 7.0E-89
sp|A2BJX6|DNLI_HYPBU DNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=lig PE=1 SV=1 207 843 1.0E-88
sp|O67398|DNLI_AQUAE Probable DNA ligase OS=Aquifex aeolicus (strain VF5) GN=lig PE=3 SV=2 209 846 1.0E-86
sp|C0QSL7|DNLI_PERMH Probable DNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=lig PE=3 SV=1 209 843 1.0E-85
sp|Q979A1|DNLI_THEVO DNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=lig PE=3 SV=1 209 844 4.0E-83
sp|A8AB20|DNLI_IGNH4 DNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=lig PE=3 SV=1 209 843 6.0E-82
sp|Q8TSR7|DNLI1_METAC DNA ligase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lig1 PE=3 SV=1 242 839 1.0E-75
sp|Q8PVR7|DNLI1_METMA DNA ligase 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lig1 PE=3 SV=1 222 839 1.0E-72
sp|Q46C04|DNLI1_METBF DNA ligase 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lig1 PE=3 SV=1 250 836 4.0E-69
sp|O59288|DNLI_PYRHO DNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=lig PE=3 SV=1 209 848 5.0E-68
sp|B8DZX8|DNLI_DICTD Probable DNA ligase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=lig PE=3 SV=1 209 843 2.0E-67
sp|P0CL75|DNLI_PYRAB DNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=lig PE=3 SV=1 209 848 3.0E-67
sp|P0CL74|DNLI_PYRAY DNA ligase OS=Pyrococcus abyssi GN=lig PE=3 SV=1 209 848 6.0E-67
sp|B5YD88|DNLI_DICT6 Probable DNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=lig PE=3 SV=1 209 843 2.0E-66
sp|P56709|DNLI_PYRFU DNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=lig PE=1 SV=1 209 848 1.0E-65
sp|B6YTR4|DNLI_THEON DNA ligase OS=Thermococcus onnurineus (strain NA1) GN=lig PE=1 SV=1 235 844 2.0E-62
sp|Q8TWN3|DNLI_METKA DNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=lig PE=3 SV=1 209 840 1.0E-61
sp|Q9HH07|DNLI_THEFM DNA ligase OS=Thermococcus fumicolans GN=lig PE=1 SV=1 209 850 2.0E-61
sp|Q9HHC4|DNLI_THEKO DNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=lig PE=1 SV=2 235 844 1.0E-60
sp|O29632|DNLI_ARCFU DNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=lig PE=1 SV=2 209 846 1.0E-59
sp|P54875|DNLI_METTF DNA ligase OS=Methanothermobacter thermautotrophicus GN=lig PE=3 SV=1 209 842 1.0E-58
sp|Q50566|DNLI_METTH DNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=lig PE=3 SV=1 209 824 2.0E-57
sp|Q8TMT1|DNLI2_METAC DNA ligase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lig2 PE=3 SV=1 209 843 2.0E-55
sp|Q74M64|DNLI_NANEQ DNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=lig PE=3 SV=1 209 843 1.0E-54
sp|Q46BA3|DNLI2_METBF DNA ligase 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lig2 PE=3 SV=1 209 843 4.0E-53
sp|Q8PTK1|DNLI2_METMA DNA ligase 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lig2 PE=3 SV=1 209 843 4.0E-52
sp|Q0W0X1|DNLI_METAR DNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=lig PE=3 SV=1 209 844 1.0E-51
sp|A0B7F9|DNLI_METTP DNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=lig PE=3 SV=1 209 843 1.0E-51
sp|A7IAA9|DNLI_METB6 DNA ligase OS=Methanoregula boonei (strain 6A8) GN=lig PE=3 SV=1 209 843 2.0E-51
sp|Q2FTH4|DNLI_METHJ DNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=lig PE=3 SV=1 209 845 2.0E-51
sp|A5UKX2|DNLI_METS3 DNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=lig PE=3 SV=1 209 843 3.0E-51
sp|A2SR38|DNLI_METLZ DNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=lig PE=3 SV=1 207 844 2.0E-49
sp|Q3IPX0|DNLI_NATPD DNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=lig PE=3 SV=1 245 836 2.0E-49
sp|Q2NHF9|DNLI_METST DNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=lig PE=3 SV=1 209 839 9.0E-49
sp|B8GGB8|DNLI_METPE DNA ligase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=lig PE=3 SV=1 209 850 2.0E-47
sp|A6UVC4|DNLI_META3 DNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=lig PE=3 SV=1 207 843 7.0E-47
sp|Q12X08|DNLI_METBU DNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=lig PE=3 SV=1 209 843 3.0E-45
sp|P16272|DNLI_VACCW DNA ligase OS=Vaccinia virus (strain Western Reserve) GN=LIG PE=1 SV=1 435 839 5.0E-45
sp|P20492|DNLI_VACCC DNA ligase OS=Vaccinia virus (strain Copenhagen) GN=LIG PE=1 SV=1 435 839 6.0E-45
sp|O57250|DNLI_VACCA DNA ligase OS=Vaccinia virus (strain Ankara) GN=LIG PE=3 SV=1 435 839 9.0E-45
sp|A6UNY0|DNLI_METVS DNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=lig PE=3 SV=1 209 840 2.0E-44
sp|Q57635|DNLI_METJA DNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=lig PE=3 SV=1 212 843 3.0E-44
sp|P33798|DNLI_VAR67 DNA ligase OS=Variola virus (isolate Human/India/Ind3/1967) GN=LIG PE=3 SV=1 435 839 8.0E-44
sp|Q67480|DNLI_FOWPN DNA ligase OS=Fowlpox virus (strain NVSL) GN=LIG PE=3 SV=2 319 840 2.0E-43
sp|Q6LYM1|DNLI_METMP DNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=lig PE=3 SV=1 209 840 3.0E-43
sp|Q9HR35|DNLI_HALSA DNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lig PE=3 SV=1 246 844 4.0E-43
sp|B0R4C9|DNLI_HALS3 DNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=lig PE=3 SV=1 246 844 4.0E-43
sp|A4FY19|DNLI_METM5 DNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=lig PE=3 SV=1 209 840 2.0E-42
sp|B9LUZ9|DNLI_HALLT DNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=lig PE=3 SV=1 245 839 4.0E-42
sp|Q5V4R0|DNLI_HALMA DNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lig PE=3 SV=1 209 843 7.0E-42
sp|A9AAX4|DNLI_METM6 DNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=lig PE=3 SV=1 209 840 7.0E-42
sp|Q54QM4|DNLI3_DICDI DNA ligase 3 OS=Dictyostelium discoideum GN=lig3 PE=3 SV=1 454 851 2.0E-41
sp|P97386|DNLI3_MOUSE DNA ligase 3 OS=Mus musculus GN=Lig3 PE=1 SV=2 461 841 3.0E-41
sp|B1L3K8|DNLI1_KORCO DNA ligase 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=lig1 PE=3 SV=1 230 843 6.0E-41
sp|A3CWP1|DNLI_METMJ DNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=lig PE=3 SV=1 209 848 2.0E-40
sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2 461 841 8.0E-40
sp|Q18GX5|DNLI2_HALWD DNA ligase 2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=lig2 PE=3 SV=1 219 825 1.0E-39
sp|A6VFQ9|DNLI_METM7 DNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=lig PE=3 SV=1 209 840 4.0E-39
sp|D4GYZ4|DNLI_HALVD DNA ligase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=lig PE=3 SV=1 246 843 4.0E-38
sp|Q8BTF7|DNLI4_MOUSE DNA ligase 4 OS=Mus musculus GN=Lig4 PE=2 SV=2 203 832 1.0E-37
sp|Q54CR9|DNLI4_DICDI DNA ligase 4 OS=Dictyostelium discoideum GN=lig4 PE=3 SV=1 373 840 2.0E-34
sp|Q90YB1|DNLI4_CHICK DNA ligase 4 OS=Gallus gallus GN=LIG4 PE=2 SV=2 373 856 3.0E-34
sp|Q1II25|DNLI_KORVE Probable DNA ligase OS=Koribacter versatilis (strain Ellin345) GN=lig PE=3 SV=1 212 843 4.0E-34
sp|P49917|DNLI4_HUMAN DNA ligase 4 OS=Homo sapiens GN=LIG4 PE=1 SV=2 203 832 1.0E-33
sp|Q5R6L3|DNLI4_PONAB DNA ligase 4 OS=Pongo abelii GN=DNL4 PE=2 SV=1 203 832 2.0E-33
sp|Q9YMV2|DNLI_NPVLD DNA ligase OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=LIG PE=1 SV=1 462 844 3.0E-33
sp|Q6C8A3|DNLI4_YARLI DNA ligase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIG4 PE=3 SV=1 480 856 3.0E-33
sp|A8N936|DNLI4_COPC7 DNA ligase 4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LIG4 PE=3 SV=2 175 848 1.0E-32
sp|Q7Z7W5|DNLI4_COPCI DNA ligase 4 OS=Coprinopsis cinerea GN=LIG4 PE=2 SV=1 175 848 1.0E-32
sp|Q18HT7|DNLI1_HALWD DNA ligase 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=lig1 PE=3 SV=1 209 843 2.0E-32
sp|Q5BH83|DNLI4_EMENI DNA ligase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lig4 PE=3 SV=1 370 839 1.0E-31
sp|B8JBM1|DNLI_ANAD2 Probable DNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lig PE=3 SV=1 319 840 2.0E-31
sp|Q2IH69|DNLI_ANADE Probable DNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lig PE=3 SV=1 335 840 6.0E-31
sp|Q2U6A1|DNLI4_ASPOR DNA ligase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lig4 PE=3 SV=1 370 839 1.0E-29
sp|A1RXA6|DNLI1_THEPD DNA ligase 1 OS=Thermofilum pendens (strain Hrk 5) GN=lig1 PE=3 SV=1 241 840 1.0E-29
sp|Q0UCI9|DNLI4_PHANO DNA ligase 4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LIG4 PE=3 SV=1 373 839 5.0E-29
sp|Q1DKE7|DNLI4_COCIM DNA ligase 4 OS=Coccidioides immitis (strain RS) GN=LIG4 PE=3 SV=1 370 839 2.0E-28
sp|B4UIS1|DNLI_ANASK Probable DNA ligase OS=Anaeromyxobacter sp. (strain K) GN=lig PE=3 SV=1 456 840 2.0E-28
sp|B2HHE1|DNLI_MYCMM Probable DNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=lig PE=3 SV=2 293 840 3.0E-27
sp|Q5YNY7|DNLI_NOCFA Probable DNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=lig PE=3 SV=1 454 832 6.0E-27
sp|O74833|DNLI4_SCHPO DNA ligase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lig4 PE=3 SV=3 224 847 4.0E-26
sp|Q9LL84|DNLI4_ARATH DNA ligase 4 OS=Arabidopsis thaliana GN=LIG4 PE=1 SV=1 368 839 5.0E-26
sp|Q7SB49|DNLI4_NEUCR DNA ligase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-53 PE=3 SV=2 270 825 1.0E-25
sp|Q9FCB1|DNLI_STRCO Probable DNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lig PE=3 SV=1 319 832 1.0E-25
sp|A0PTC0|DNLI_MYCUA Probable DNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=lig PE=3 SV=1 293 840 8.0E-25
sp|Q4WVG8|DNLI4_ASPFU DNA ligase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lig4 PE=3 SV=1 370 839 8.0E-25
sp|A0QUP1|DNLI_MYCS2 DNA ligase B OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ligB PE=3 SV=1 293 842 1.0E-24
sp|Q826P6|DNLI_STRAW Probable DNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lig PE=3 SV=1 319 840 4.0E-24
sp|B1ZZL9|DNLI_OPITP Probable DNA ligase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=lig PE=3 SV=1 205 832 1.0E-23
sp|Q1BB26|DNLI_MYCSS Probable DNA ligase OS=Mycobacterium sp. (strain MCS) GN=lig PE=3 SV=1 293 840 2.0E-23
sp|A1UDY9|DNLI_MYCSK Probable DNA ligase OS=Mycobacterium sp. (strain KMS) GN=lig PE=3 SV=1 293 840 2.0E-23
sp|A3PXE2|DNLI_MYCSJ Probable DNA ligase OS=Mycobacterium sp. (strain JLS) GN=lig PE=3 SV=1 293 840 2.0E-23
sp|Q0SG75|DNLI_RHOJR Probable DNA ligase OS=Rhodococcus jostii (strain RHA1) GN=lig PE=3 SV=1 319 832 4.0E-23
sp|A4TDS2|DNLI_MYCGI Probable DNA ligase OS=Mycobacterium gilvum (strain PYR-GCK) GN=lig PE=3 SV=1 293 842 5.0E-23
sp|C1AX87|DNLI_RHOOB Probable DNA ligase OS=Rhodococcus opacus (strain B4) GN=lig PE=3 SV=1 319 832 7.0E-23
sp|A4F870|DNLI_SACEN Probable DNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=lig PE=3 SV=1 319 849 2.0E-22
sp|P9WNV4|DNLI_MYCTO DNA ligase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ligB PE=3 SV=1 453 840 5.0E-22
sp|C1AGI1|DNLI_MYCBT Probable DNA ligase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lig PE=3 SV=1 453 840 5.0E-22
sp|A1KN60|DNLI_MYCBP Probable DNA ligase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lig PE=3 SV=1 453 840 5.0E-22
sp|Q7TTR7|DNLI_MYCBO Probable DNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lig PE=3 SV=1 453 840 5.0E-22
sp|P9WNV5|DNLI_MYCTU DNA ligase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ligB PE=1 SV=1 453 840 6.0E-22
sp|A5U776|DNLI_MYCTA Probable DNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lig PE=3 SV=1 453 840 6.0E-22
sp|Q73V97|DNLI_MYCPA Probable DNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lig PE=3 SV=1 453 840 2.0E-21
sp|B8HCE1|DNLI_ARTCA Probable DNA ligase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=lig PE=3 SV=1 453 841 4.0E-21
sp|A0QJL0|DNLI_MYCA1 Probable DNA ligase OS=Mycobacterium avium (strain 104) GN=lig PE=3 SV=1 453 840 4.0E-21
sp|B1W5J2|DNLI_STRGG Probable DNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lig PE=3 SV=1 319 841 6.0E-21
sp|Q08387|DNLI4_YEAST DNA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNL4 PE=1 SV=1 453 719 9.0E-21
sp|Q6FVD8|DNLI4_CANGA DNA ligase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LIG4 PE=3 SV=1 454 702 1.0E-20
sp|Q6CSH0|DNLI4_KLULA DNA ligase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LIG4 PE=3 SV=1 463 741 1.0E-19
sp|A1T6P2|DNLI_MYCVP Probable DNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=lig PE=3 SV=1 373 842 3.0E-19
sp|A7HID3|DNLI_ANADF Probable DNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lig PE=3 SV=1 456 843 7.0E-19
sp|Q75CA4|DNLI4_ASHGO DNA ligase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LIG4 PE=3 SV=1 452 707 3.0E-18
sp|P52496|DNLI4_CANAL DNA ligase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIG4 PE=2 SV=3 486 859 2.0E-17
sp|Q7X7E9|DNLI4_ORYSJ Putative DNA ligase 4 OS=Oryza sativa subsp. japonica GN=LIG4 PE=2 SV=2 460 857 4.0E-16
sp|P0CN08|DNLI4_CRYNJ DNA ligase 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LIG4 PE=3 SV=1 486 825 2.0E-15
sp|P0CN09|DNLI4_CRYNB DNA ligase 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LIG4 PE=3 SV=1 486 825 2.0E-15
sp|A9GU24|DNLI_SORC5 Probable DNA ligase OS=Sorangium cellulosum (strain So ce56) GN=lig PE=3 SV=1 297 840 4.0E-14
sp|A0R3R7|LIGD_MYCS2 Multifunctional non-homologous end joining protein LigD OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ligD PE=1 SV=2 450 829 9.0E-14
sp|A6WG40|DNLI_KINRD Probable DNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lig PE=3 SV=1 457 841 1.0E-13
sp|A1SKL2|DNLI_NOCSJ Probable DNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=lig PE=3 SV=1 455 825 4.0E-13
sp|Q9I1X7|LIGD_PSEAE Multifunctional non-homologous end joining protein LigD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ligD PE=1 SV=1 520 834 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006310 DNA recombination Yes
GO:0003677 DNA binding Yes
GO:0006281 DNA repair Yes
GO:0003910 DNA ligase (ATP) activity Yes
GO:0005524 ATP binding Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0051716 cellular response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0003909 DNA ligase activity No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006950 response to stress No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2548
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4842
Ophiocordyceps australis map64 (Brazil) OphauB2|3578
Ophiocordyceps camponoti-floridani Ophcf2|01886
Ophiocordyceps camponoti-rufipedis Ophun1|4670 (this protein)
Ophiocordyceps kimflemingae Ophio5|4043
Ophiocordyceps subramaniannii Hirsu2|377

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4670
MAPKQATLGYVKPEQSTLRKFFGGKGEAPLRQAKLGFATGGKKKDAAESDQGGRKRGAKDKSADEDDGSPVAKRP
RRSRVKIEDDEDDEAMVESAEVEKEPKREKAASPADKKIADGPDGKGSKKKRTRVKEETQVKEEPKDETLIKEDV
SDKEAQESAAESGSEAEAEADEVKPEVAAKAREKAQAQLKTKKQAHPYPDWKAGAPVPYAALCQTFSLIEMTTKR
LVIMDHCSLFLRQVMRLTPEDLLPTVLLMVNKLAPDYVGIELGIGESLIMKAIGETTGRSLQVIKADQKEIGDLG
LVAVKSRSTQPTMFKPKPLTVRGVHQGLMAIATVTGGGAQGRKVDGIKKLLSAADASGSGKVDIGKDKGGPSEAK
FIVRFLEGKLRLGLAERTVLVSLAQAVVCHEAEQKGGVPSTAELEKGESMLKTVYSELPSYDVIVPAVLEHGIDK
LRDEVKLRPGVPLKPMLAKPTKAITEVLDRFDGQTFTCEYKYDGERAQIHYVAKEAPQQVVGAAKEAAGGLACIF
SRNSEDLSNKYPDILAKLHTWIGPETMSFVLDCETVAWDVEERKVLPFQQLMTRKRKDVKVEDVKVKVCVFAFDL
LYLNGEAVVEKPLRERRELLRQAFIPVEGEFAFASSMDGQELDEIQGFLDESVKASCEGLMVKMLDGSESGYEPS
KRSRNWLKIKKDYLSGIGDSLDLVVIGAYHGRGKRTSVYGAFLLACYNSTTETYESVCNIGTGFSEAMLESLHSQ
LSATAIDRPKPFYSHASSAQHQPDIWLDARFVWEVKTADLTLSPRYKAASADDSVPSGRGISLRFPRFVRVREDK
RPEQATTSRQVVEMYRKQESVAGGRAPAVDDDFEY*
Coding >Ophun1|4670
ATGGCGCCGAAGCAGGCGACGCTGGGGTACGTCAAGCCGGAGCAGAGCACGCTGCGCAAGTTCTTTGGTGGCAAG
GGGGAGGCGCCGCTGCGGCAGGCGAAGTTGGGGTTTGCTACGGGGGGGAAGAAGAAGGATGCGGCTGAATCGGAT
CAAGGTGGCAGGAAACGCGGCGCCAAGGATAAGTCGGCCGACGAAGACGATGGAAGTCCGGTGGCGAAGCGCCCG
AGAAGATCACGGGTCAAGATTGAGGATGACGAAGACGATGAGGCGATGGTGGAGAGCGCTGAGGTTGAAAAGGAG
CCGAAACGAGAAAAAGCAGCTTCGCCGGCCGACAAGAAGATTGCTGATGGCCCTGACGGCAAGGGCTCGAAGAAG
AAACGCACTCGAGTGAAAGAGGAGACTCAGGTCAAGGAGGAGCCGAAGGATGAAACTCTGATCAAGGAAGACGTC
TCCGACAAAGAAGCTCAAGAGTCGGCAGCCGAGTCCGGATCCGAGGCAGAGGCCGAGGCTGACGAGGTGAAGCCC
GAGGTGGCCGCCAAGGCGCGAGAGAAAGCCCAGGCGCAGCTCAAGACCAAGAAGCAAGCGCATCCATATCCGGAC
TGGAAGGCCGGAGCTCCTGTTCCGTACGCGGCGCTATGCCAGACGTTTTCTCTCATTGAGATGACGACGAAGCGG
CTGGTCATTATGGATCACTGCTCGCTGTTCCTCCGGCAGGTGATGAGGCTCACCCCTGAAGACCTGTTGCCGACG
GTGCTCCTCATGGTCAATAAGCTCGCGCCCGACTACGTTGGCATCGAGCTTGGCATTGGCGAGTCGCTCATCATG
AAGGCCATTGGCGAAACAACAGGGCGCAGTCTTCAGGTTATCAAGGCCGACCAGAAGGAGATTGGCGACCTGGGT
CTGGTGGCGGTAAAGAGCAGGTCGACGCAGCCCACCATGTTCAAGCCGAAGCCTCTGACGGTCAGGGGCGTCCAT
CAAGGCTTGATGGCTATCGCGACGGTGACGGGCGGCGGCGCGCAGGGCAGGAAAGTGGATGGCATCAAGAAGCTG
CTTTCGGCTGCCGACGCCAGCGGCTCGGGAAAGGTCGATATTGGCAAGGACAAGGGCGGGCCGAGCGAGGCCAAG
TTTATTGTTCGCTTCCTCGAGGGCAAGCTGAGGCTTGGTCTTGCTGAGAGGACTGTTCTCGTCTCCTTGGCTCAG
GCTGTTGTCTGTCACGAGGCTGAGCAGAAGGGTGGTGTGCCGAGCACGGCGGAGCTGGAGAAGGGGGAGTCGATG
CTCAAGACGGTCTACAGCGAGCTTCCCAGCTACGACGTCATCGTCCCAGCCGTTCTCGAGCACGGCATCGACAAG
CTCAGAGACGAGGTCAAGCTGCGGCCTGGCGTGCCGCTCAAGCCGATGCTGGCCAAGCCGACCAAGGCCATCACC
GAGGTGCTGGACCGGTTCGACGGTCAGACGTTTACCTGCGAGTACAAGTACGACGGCGAGCGAGCTCAGATTCAC
TACGTGGCCAAGGAGGCACCGCAGCAGGTTGTCGGCGCGGCTAAGGAGGCGGCCGGCGGCTTGGCCTGTATCTTC
TCGCGCAACTCGGAGGACCTGTCCAACAAGTATCCCGACATCCTGGCCAAGCTGCACACGTGGATCGGCCCCGAG
ACGATGAGCTTCGTGCTCGACTGCGAGACGGTGGCGTGGGACGTTGAGGAGCGCAAGGTGCTTCCCTTTCAGCAG
CTGATGACGCGCAAACGCAAGGACGTCAAGGTCGAAGACGTAAAGGTCAAGGTCTGCGTCTTCGCCTTCGATCTC
CTCTACCTCAACGGCGAGGCCGTGGTGGAAAAGCCGCTGCGGGAACGGAGAGAACTGCTGCGGCAGGCCTTTATA
CCCGTCGAGGGCGAGTTTGCTTTTGCTTCCTCGATGGATGGTCAGGAGCTGGATGAGATTCAGGGCTTCTTGGAT
GAGAGCGTCAAGGCATCGTGCGAAGGGCTGATGGTCAAGATGCTCGATGGAAGCGAGAGCGGGTATGAGCCCAGC
AAGAGGAGTCGGAACTGGCTCAAGATCAAAAAGGATTACCTCTCCGGCATCGGAGACTCTCTCGACCTCGTCGTC
ATCGGCGCCTACCACGGCCGCGGGAAACGCACCTCTGTCTACGGAGCCTTCCTGCTGGCCTGCTACAACAGCACG
ACAGAAACCTACGAAAGCGTCTGCAACATCGGCACCGGCTTCTCAGAGGCCATGCTCGAATCCCTCCACTCCCAA
CTCTCCGCCACAGCCATCGACCGCCCGAAGCCCTTCTACTCGCACGCCTCGTCGGCCCAGCACCAGCCCGACATC
TGGCTCGACGCCCGCTTCGTCTGGGAGGTCAAGACGGCGGATCTGACGCTCAGTCCCAGGTATAAGGCTGCCTCG
GCGGATGATTCCGTCCCCAGCGGCAGGGGGATTAGCCTCAGGTTTCCTCGGTTTGTGCGCGTGCGTGAGGATAAG
AGGCCGGAGCAGGCGACGACGAGTCGGCAGGTTGTTGAGATGTATCGGAAGCAGGAGAGTGTTGCGGGGGGGAGG
GCGCCGGCGGTGGATGATGATTTCGAGTATTAG
Transcript >Ophun1|4670
ATGGCGCCGAAGCAGGCGACGCTGGGGTACGTCAAGCCGGAGCAGAGCACGCTGCGCAAGTTCTTTGGTGGCAAG
GGGGAGGCGCCGCTGCGGCAGGCGAAGTTGGGGTTTGCTACGGGGGGGAAGAAGAAGGATGCGGCTGAATCGGAT
CAAGGTGGCAGGAAACGCGGCGCCAAGGATAAGTCGGCCGACGAAGACGATGGAAGTCCGGTGGCGAAGCGCCCG
AGAAGATCACGGGTCAAGATTGAGGATGACGAAGACGATGAGGCGATGGTGGAGAGCGCTGAGGTTGAAAAGGAG
CCGAAACGAGAAAAAGCAGCTTCGCCGGCCGACAAGAAGATTGCTGATGGCCCTGACGGCAAGGGCTCGAAGAAG
AAACGCACTCGAGTGAAAGAGGAGACTCAGGTCAAGGAGGAGCCGAAGGATGAAACTCTGATCAAGGAAGACGTC
TCCGACAAAGAAGCTCAAGAGTCGGCAGCCGAGTCCGGATCCGAGGCAGAGGCCGAGGCTGACGAGGTGAAGCCC
GAGGTGGCCGCCAAGGCGCGAGAGAAAGCCCAGGCGCAGCTCAAGACCAAGAAGCAAGCGCATCCATATCCGGAC
TGGAAGGCCGGAGCTCCTGTTCCGTACGCGGCGCTATGCCAGACGTTTTCTCTCATTGAGATGACGACGAAGCGG
CTGGTCATTATGGATCACTGCTCGCTGTTCCTCCGGCAGGTGATGAGGCTCACCCCTGAAGACCTGTTGCCGACG
GTGCTCCTCATGGTCAATAAGCTCGCGCCCGACTACGTTGGCATCGAGCTTGGCATTGGCGAGTCGCTCATCATG
AAGGCCATTGGCGAAACAACAGGGCGCAGTCTTCAGGTTATCAAGGCCGACCAGAAGGAGATTGGCGACCTGGGT
CTGGTGGCGGTAAAGAGCAGGTCGACGCAGCCCACCATGTTCAAGCCGAAGCCTCTGACGGTCAGGGGCGTCCAT
CAAGGCTTGATGGCTATCGCGACGGTGACGGGCGGCGGCGCGCAGGGCAGGAAAGTGGATGGCATCAAGAAGCTG
CTTTCGGCTGCCGACGCCAGCGGCTCGGGAAAGGTCGATATTGGCAAGGACAAGGGCGGGCCGAGCGAGGCCAAG
TTTATTGTTCGCTTCCTCGAGGGCAAGCTGAGGCTTGGTCTTGCTGAGAGGACTGTTCTCGTCTCCTTGGCTCAG
GCTGTTGTCTGTCACGAGGCTGAGCAGAAGGGTGGTGTGCCGAGCACGGCGGAGCTGGAGAAGGGGGAGTCGATG
CTCAAGACGGTCTACAGCGAGCTTCCCAGCTACGACGTCATCGTCCCAGCCGTTCTCGAGCACGGCATCGACAAG
CTCAGAGACGAGGTCAAGCTGCGGCCTGGCGTGCCGCTCAAGCCGATGCTGGCCAAGCCGACCAAGGCCATCACC
GAGGTGCTGGACCGGTTCGACGGTCAGACGTTTACCTGCGAGTACAAGTACGACGGCGAGCGAGCTCAGATTCAC
TACGTGGCCAAGGAGGCACCGCAGCAGGTTGTCGGCGCGGCTAAGGAGGCGGCCGGCGGCTTGGCCTGTATCTTC
TCGCGCAACTCGGAGGACCTGTCCAACAAGTATCCCGACATCCTGGCCAAGCTGCACACGTGGATCGGCCCCGAG
ACGATGAGCTTCGTGCTCGACTGCGAGACGGTGGCGTGGGACGTTGAGGAGCGCAAGGTGCTTCCCTTTCAGCAG
CTGATGACGCGCAAACGCAAGGACGTCAAGGTCGAAGACGTAAAGGTCAAGGTCTGCGTCTTCGCCTTCGATCTC
CTCTACCTCAACGGCGAGGCCGTGGTGGAAAAGCCGCTGCGGGAACGGAGAGAACTGCTGCGGCAGGCCTTTATA
CCCGTCGAGGGCGAGTTTGCTTTTGCTTCCTCGATGGATGGTCAGGAGCTGGATGAGATTCAGGGCTTCTTGGAT
GAGAGCGTCAAGGCATCGTGCGAAGGGCTGATGGTCAAGATGCTCGATGGAAGCGAGAGCGGGTATGAGCCCAGC
AAGAGGAGTCGGAACTGGCTCAAGATCAAAAAGGATTACCTCTCCGGCATCGGAGACTCTCTCGACCTCGTCGTC
ATCGGCGCCTACCACGGCCGCGGGAAACGCACCTCTGTCTACGGAGCCTTCCTGCTGGCCTGCTACAACAGCACG
ACAGAAACCTACGAAAGCGTCTGCAACATCGGCACCGGCTTCTCAGAGGCCATGCTCGAATCCCTCCACTCCCAA
CTCTCCGCCACAGCCATCGACCGCCCGAAGCCCTTCTACTCGCACGCCTCGTCGGCCCAGCACCAGCCCGACATC
TGGCTCGACGCCCGCTTCGTCTGGGAGGTCAAGACGGCGGATCTGACGCTCAGTCCCAGGTATAAGGCTGCCTCG
GCGGATGATTCCGTCCCCAGCGGCAGGGGGATTAGCCTCAGGTTTCCTCGGTTTGTGCGCGTGCGTGAGGATAAG
AGGCCGGAGCAGGCGACGACGAGTCGGCAGGTTGTTGAGATGTATCGGAAGCAGGAGAGTGTTGCGGGGGGGAGG
GCGCCGGCGGTGGATGATGATTTCGAGTATTAG
Gene >Ophun1|4670
ATGGCGCCGAAGCAGGCGACGCTGGGGTACGTCAAGCCGGAGCAGAGCACGCTGCGGTGTGTTTCGAGGCTTCTA
CTGGATTGTTGATGAAGGTTCTGACGACTCGATAGCAAGTTCTTTGGTGGCAAGGGGGAGGCGCCGCTGCGGCAG
GCGAAGTTGGGGTTTGCTACGGGGGGGAAGAAGAAGGATGCGGCTGAATCGGATCAAGGTGAGTATTTTGGCCTC
GTTCTGAGCTACTCAGCAGCTGATGTTTATGTTCTTCAAGGTGGCAGGAAACGCGGCGCCAAGGATAAGTCGGCC
GACGAAGACGATGGAAGTCCGGTGGCGAAGCGCCCGAGAAGATCACGGGTCAAGATTGAGGATGACGAAGACGAT
GAGGCGATGGTGGAGAGCGCTGAGGTTGAAAAGGAGCCGAAACGAGAAAAAGCAGCTTCGCCGGCCGACAAGAAG
ATTGCTGATGGCCCTGACGGCAAGGGCTCGAAGAAGAAACGCACTCGAGTGAAAGAGGAGACTCAGGTCAAGGAG
GAGCCGAAGGATGAAACTCTGATCAAGGAAGACGTCTCCGACAAAGAAGCTCAAGAGTCGGCAGCCGAGTCCGGA
TCCGAGGCAGAGGCCGAGGCTGACGAGGTGAAGCCCGAGGTGGCCGCCAAGGCGCGAGAGAAAGCCCAGGCGCAG
CTCAAGACCAAGAAGCAAGCGCATCCATATCCGGACTGGAAGGCCGGAGCTCCTGTTCCGTACGCGGCGCTATGC
CAGACGTTTTCTCTCATTGAGATGACGACGAAGCGGCTGGTCATTATGGATCACTGCTCGCTGTTCCTCCGGCAG
GTGATGAGGCTCACCCCTGAAGACCTGTTGCCGACGGTGCTCCTCATGGTCAATAAGCTCGCGCCCGACTACGTT
GGCATCGAGCTTGGCATTGGCGAGTCGCTCATCATGAAGGCCATTGGCGAAACAACAGGGCGCAGTCTTCAGGTT
ATCAAGGCCGACCAGAAGGAGATTGGCGACCTGGGTCTGGTGGCGGTAAAGAGCAGGTCGACGCAGCCCACCATG
TTCAAGCCGAAGCCTCTGACGGTCAGGGGCGTCCATCAAGGCTTGATGGCTATCGCGACGGTGACGGGCGGCGGC
GCGCAGGGCAGGAAAGTGGATGGCATCAAGAAGCTGCTTTCGGCTGCCGACGCCAGCGGCTCGGGAAAGGTCGAT
ATTGGCAAGGACAAGGGCGGGCCGAGCGAGGCCAAGTTTATTGTTCGCTTCCTCGAGGGCAAGCTGAGGCTTGGT
CTTGCTGAGAGGACTGTTCTCGTCTCCTTGGCTCAGGCTGTTGTCTGTCACGAGGCTGAGCAGAAGGGTGGTGTG
CCGAGCACGGCGGAGCTGGAGAAGGGGGAGTCGATGCTCAAGACGGTCTACAGGTATGTCGTCCCCTCGGTCTTG
AGATATATATGTGCGTGTGTTGTGTGTCTTGTACAGCGTCTCTGACAAGCCCTCGTCCGCAGCGAGCTTCCCAGC
TACGACGTCATCGTCCCAGCCGTTCTCGAGCACGGCATCGACAAGCTCAGAGACGAGGTCAAGCTGCGGCCTGGC
GTGCCGCTCAAGCCGATGCTGGCCAAGCCGACCAAGGCCATCACCGAGGTGCTGGACCGGTTCGACGGTCAGACG
TTTACCTGCGAGTACAAGTACGACGGCGAGCGAGCTCAGATTCACTACGTGGCCAAGGAGGCACCGCAGCAGGTT
GTCGGCGCGGCTAAGGAGGCGGCCGGCGGCTTGGCCTGTATCTTCTCGCGCAACTCGGAGGACCTGTCCAACAAG
TATCCCGACATCCTGGCCAAGCTGCACACGTGGATCGGCCCCGAGACGATGAGCTTCGTGCTCGACTGCGAGACG
GTGGCGTGGGACGTTGAGGAGCGCAAGGTGCTTCCCTTTCAGCAGCTGATGACGCGCAAACGCAAGGACGTCAAG
GTCGAAGACGTAAAGGTCAAGGTCTGCGTCTTCGCCTTCGATCTCCTCTACCTCAACGGCGAGGCCGTGGTGGAA
AAGCCGCTGCGGGAACGGAGAGAACTGCTGCGGCAGGCCTTTATACCCGTCGAGGGCGAGTTTGCTTTTGCTTCC
TCGATGGATGGTCAGGAGCTGGATGAGATTCAGGGCTTCTTGGATGAGAGCGTCAAGGCATCGTGCGAAGGGCTG
ATGGTCAAGATGCTCGATGGAAGCGAGAGCGGGTATGAGCCCAGCAAGAGGAGTCGGAACTGGCTCAAGGTATGT
TGCTCACCGTTATGACGTTGCTTGGACACTGCTGATGAAGCTCATCCCCTCAGATCAAAAAGGATTACCTCTCCG
GCATCGGAGACTCTCTCGACCTCGTCGTCATCGGCGCCTACCACGGCCGCGGGAAACGCACCTCTGTCTACGGAG
CCTTCCTGCTGGCCTGCTACAACAGCACGACAGAAACCTACGAAAGCGTCTGCAACATCGGCACCGGCTTCTCAG
AGGCCATGCTCGAATCCCTCCACTCCCAACTCTCCGCCACAGCCATCGACCGCCCGAAGCCCTTCTACTCGCACG
CCTCGTCGGCCCAGCACCAGCCCGACATCTGGCTCGACGCCCGCTTCGTCTGGGAGGTCAAGACGGCGGATCTGA
CGCTCAGTCCCAGGTATAAGGCTGCCTCGGCGGATGATTCCGTCCCCAGCGGCAGGGGGATTAGCCTCAGGTTTC
CTCGGTTTGTGCGCGTGCGTGAGGATAAGAGGCCGGAGCAGGCGACGACGAGTCGGCAGGTTGTTGAGATGTATC
GGAAGCAGGAGAGTGTTGCGGGGGGGAGGGCGCCGGCGGTGGATGATGATTTCGAGTATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail