Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|467
Gene name
LocationContig_113:23265..24688
Strand-
Gene length (bp)1423
Transcript length (bp)1335
Coding sequence length (bp)1335
Protein length (aa) 445

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04377 ATE_C Arginine-tRNA-protein transferase, C terminus 8.8E-43 161 297
PF04376 ATE_N Arginine-tRNA-protein transferase, N terminus 1.7E-21 30 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14133|ATE1_SCHPO Arginyl-tRNA--protein transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.07c PE=3 SV=3 36 442 2.0E-59
sp|P16639|ATE1_YEAST Arginyl-tRNA--protein transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATE1 PE=1 SV=2 39 297 2.0E-29
sp|Q9ZT48|ATE1_ARATH Arginyl-tRNA--protein transferase 1 OS=Arabidopsis thaliana GN=ATE1 PE=2 SV=2 148 322 8.0E-27
sp|Q9Z2A5|ATE1_MOUSE Arginyl-tRNA--protein transferase 1 OS=Mus musculus GN=Ate1 PE=1 SV=2 142 332 9.0E-27
sp|Q9C776|ATE2_ARATH Arginyl-tRNA--protein transferase 2 OS=Arabidopsis thaliana GN=ATE2 PE=2 SV=1 148 361 6.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14133|ATE1_SCHPO Arginyl-tRNA--protein transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.07c PE=3 SV=3 36 442 2.0E-59
sp|P16639|ATE1_YEAST Arginyl-tRNA--protein transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATE1 PE=1 SV=2 39 297 2.0E-29
sp|Q9ZT48|ATE1_ARATH Arginyl-tRNA--protein transferase 1 OS=Arabidopsis thaliana GN=ATE1 PE=2 SV=2 148 322 8.0E-27
sp|Q9Z2A5|ATE1_MOUSE Arginyl-tRNA--protein transferase 1 OS=Mus musculus GN=Ate1 PE=1 SV=2 142 332 9.0E-27
sp|Q9C776|ATE2_ARATH Arginyl-tRNA--protein transferase 2 OS=Arabidopsis thaliana GN=ATE2 PE=2 SV=1 148 361 6.0E-26
sp|O95260|ATE1_HUMAN Arginyl-tRNA--protein transferase 1 OS=Homo sapiens GN=ATE1 PE=1 SV=2 110 317 1.0E-25
sp|Q2PFX0|ATE1_MACFA Arginyl-tRNA--protein transferase 1 OS=Macaca fascicularis GN=ATE1 PE=2 SV=1 142 317 2.0E-24
sp|O96539|ATE1_DROME Arginyl-tRNA--protein transferase 1 OS=Drosophila melanogaster GN=Ate1 PE=2 SV=3 161 340 3.0E-23
sp|Q55EI0|ATE1_DICDI Arginyl-tRNA--protein transferase 1 OS=Dictyostelium discoideum GN=ate1 PE=3 SV=1 211 303 3.0E-17
sp|Q55EI0|ATE1_DICDI Arginyl-tRNA--protein transferase 1 OS=Dictyostelium discoideum GN=ate1 PE=3 SV=1 44 107 2.0E-14
sp|Q4K9V0|ATE_PSEF5 Putative arginyl-tRNA--protein transferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ate PE=3 SV=1 52 307 7.0E-13
sp|Q3KA78|ATE_PSEPF Putative arginyl-tRNA--protein transferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ate PE=3 SV=1 52 307 1.0E-12
sp|C3JY60|ATE_PSEFS Putative arginyl-tRNA--protein transferase OS=Pseudomonas fluorescens (strain SBW25) GN=ate PE=3 SV=1 52 296 9.0E-12
sp|Q88FS6|ATE_PSEPK Putative arginyl-tRNA--protein transferase OS=Pseudomonas putida (strain KT2440) GN=ate PE=3 SV=1 52 296 2.0E-11
sp|A5W1H0|ATE_PSEP1 Putative arginyl-tRNA--protein transferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ate PE=3 SV=1 52 296 3.0E-11
sp|B0KLX4|ATE_PSEPG Putative arginyl-tRNA--protein transferase OS=Pseudomonas putida (strain GB-1) GN=ate PE=3 SV=1 52 296 4.0E-11
sp|B1JBE6|ATE_PSEPW Putative arginyl-tRNA--protein transferase OS=Pseudomonas putida (strain W619) GN=ate PE=3 SV=1 52 296 9.0E-11
sp|Q1H2E4|ATE_METFK Putative arginyl-tRNA--protein transferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ate1 PE=3 SV=1 44 293 1.0E-10
sp|Q21K29|ATE_SACD2 Putative arginyl-tRNA--protein transferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ate PE=3 SV=1 38 292 2.0E-10
sp|Q87ZS3|ATE_PSESM Putative arginyl-tRNA--protein transferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ate PE=3 SV=1 39 296 3.0E-10
sp|Q1IBD6|ATE_PSEE4 Putative arginyl-tRNA--protein transferase OS=Pseudomonas entomophila (strain L48) GN=ate PE=3 SV=1 52 296 3.0E-10
sp|A4VLV4|ATE_PSEU5 Putative arginyl-tRNA--protein transferase OS=Pseudomonas stutzeri (strain A1501) GN=ate PE=3 SV=1 158 296 4.0E-10
sp|Q9Z2A5|ATE1_MOUSE Arginyl-tRNA--protein transferase 1 OS=Mus musculus GN=Ate1 PE=1 SV=2 25 131 6.0E-10
sp|Q9C776|ATE2_ARATH Arginyl-tRNA--protein transferase 2 OS=Arabidopsis thaliana GN=ATE2 PE=2 SV=1 44 134 8.0E-10
sp|Q48H68|ATE_PSE14 Putative arginyl-tRNA--protein transferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ate PE=3 SV=1 39 296 1.0E-09
sp|P59794|ATE_HELHP Putative arginyl-tRNA--protein transferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ate PE=3 SV=1 213 299 2.0E-09
sp|Q9ZT48|ATE1_ARATH Arginyl-tRNA--protein transferase 1 OS=Arabidopsis thaliana GN=ATE1 PE=2 SV=2 17 100 3.0E-09
sp|Q2PFX0|ATE1_MACFA Arginyl-tRNA--protein transferase 1 OS=Macaca fascicularis GN=ATE1 PE=2 SV=1 36 131 3.0E-09
sp|A4XUY1|ATE_PSEMY Putative arginyl-tRNA--protein transferase OS=Pseudomonas mendocina (strain ymp) GN=ate PE=3 SV=1 52 292 3.0E-09
sp|B1YPI7|ATE_BURA4 Putative arginyl-tRNA--protein transferase OS=Burkholderia ambifaria (strain MC40-6) GN=ate PE=3 SV=1 43 333 3.0E-09
sp|Q9I0M0|ATE_PSEAE Putative arginyl-tRNA--protein transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ate PE=3 SV=1 39 292 4.0E-09
sp|Q02NB0|ATE_PSEAB Putative arginyl-tRNA--protein transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ate PE=3 SV=1 39 292 4.0E-09
sp|B7UV23|ATE_PSEA8 Putative arginyl-tRNA--protein transferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ate PE=3 SV=1 39 292 4.0E-09
sp|O95260|ATE1_HUMAN Arginyl-tRNA--protein transferase 1 OS=Homo sapiens GN=ATE1 PE=1 SV=2 36 131 5.0E-09
sp|Q4ZRK9|ATE_PSEU2 Putative arginyl-tRNA--protein transferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ate PE=3 SV=1 39 296 6.0E-09
sp|A6V4G8|ATE_PSEA7 Putative arginyl-tRNA--protein transferase OS=Pseudomonas aeruginosa (strain PA7) GN=ate PE=3 SV=1 39 292 6.0E-09
sp|A3N926|ATE_BURP6 Putative arginyl-tRNA--protein transferase OS=Burkholderia pseudomallei (strain 668) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|Q3JSS7|ATE_BURP1 Putative arginyl-tRNA--protein transferase OS=Burkholderia pseudomallei (strain 1710b) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|A3NUS2|ATE_BURP0 Putative arginyl-tRNA--protein transferase OS=Burkholderia pseudomallei (strain 1106a) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|A1V4A4|ATE_BURMS Putative arginyl-tRNA--protein transferase OS=Burkholderia mallei (strain SAVP1) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|Q62K46|ATE_BURMA Putative arginyl-tRNA--protein transferase OS=Burkholderia mallei (strain ATCC 23344) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|A2S373|ATE_BURM9 Putative arginyl-tRNA--protein transferase OS=Burkholderia mallei (strain NCTC 10229) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|A3MJ99|ATE_BURM7 Putative arginyl-tRNA--protein transferase OS=Burkholderia mallei (strain NCTC 10247) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|Q2SVM0|ATE_BURTA Putative arginyl-tRNA--protein transferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|Q63TV2|ATE_BURPS Putative arginyl-tRNA--protein transferase OS=Burkholderia pseudomallei (strain K96243) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|Q0BFQ9|ATE_BURCM Putative arginyl-tRNA--protein transferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ate PE=3 SV=1 43 333 7.0E-09
sp|A1WWV3|ATE_HALHL Putative arginyl-tRNA--protein transferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ate PE=3 SV=1 219 297 1.0E-08
sp|B2T3H8|ATE_BURPP Putative arginyl-tRNA--protein transferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ate PE=3 SV=1 44 313 2.0E-08
sp|Q39GX4|ATE_BURL3 Putative arginyl-tRNA--protein transferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ate PE=3 SV=1 43 333 3.0E-08
sp|A1VN09|ATE_POLNA Putative arginyl-tRNA--protein transferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=ate PE=3 SV=1 44 297 3.0E-08
sp|A0K730|ATE_BURCH Putative arginyl-tRNA--protein transferase OS=Burkholderia cenocepacia (strain HI2424) GN=ate PE=3 SV=1 43 333 3.0E-08
sp|B1K0S5|ATE_BURCC Putative arginyl-tRNA--protein transferase OS=Burkholderia cenocepacia (strain MC0-3) GN=ate PE=3 SV=1 43 333 3.0E-08
sp|Q1BWM3|ATE_BURCA Putative arginyl-tRNA--protein transferase OS=Burkholderia cenocepacia (strain AU 1054) GN=ate PE=3 SV=1 43 333 3.0E-08
sp|A4JE23|ATE_BURVG Putative arginyl-tRNA--protein transferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ate PE=3 SV=1 43 333 4.0E-08
sp|B4E8N5|ATE_BURCJ Putative arginyl-tRNA--protein transferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ate PE=3 SV=1 43 333 4.0E-08
sp|Q0A7X7|ATE_ALKEH Putative arginyl-tRNA--protein transferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ate PE=3 SV=1 222 297 4.0E-08
sp|Q13ZM2|ATE_BURXL Putative arginyl-tRNA--protein transferase OS=Burkholderia xenovorans (strain LB400) GN=ate PE=3 SV=1 44 313 5.0E-08
sp|A9AJX3|ATE_BURM1 Putative arginyl-tRNA--protein transferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ate PE=3 SV=1 43 333 5.0E-08
sp|Q7NX30|ATE_CHRVO Putative arginyl-tRNA--protein transferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ate PE=3 SV=1 36 296 6.0E-08
sp|A4G7T6|ATE_HERAR Putative arginyl-tRNA--protein transferase OS=Herminiimonas arsenicoxydans GN=ate PE=3 SV=1 44 292 7.0E-08
sp|A8FM84|ATE_CAMJ8 Putative arginyl-tRNA--protein transferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=ate PE=3 SV=1 213 296 7.0E-08
sp|Q5HU66|ATE_CAMJR Putative arginyl-tRNA--protein transferase OS=Campylobacter jejuni (strain RM1221) GN=ate PE=3 SV=1 213 296 7.0E-08
sp|A1W023|ATE_CAMJJ Putative arginyl-tRNA--protein transferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=ate PE=3 SV=1 213 296 7.0E-08
sp|Q9PNQ6|ATE_CAMJE Putative arginyl-tRNA--protein transferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ate PE=3 SV=1 213 296 7.0E-08
sp|Q5FUV3|ATE_GLUOX Putative arginyl-tRNA--protein transferase OS=Gluconobacter oxydans (strain 621H) GN=ate PE=3 SV=1 149 296 9.0E-08
sp|A7H303|ATE_CAMJD Putative arginyl-tRNA--protein transferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=ate PE=3 SV=1 213 296 1.0E-07
sp|Q0VQ13|ATE_ALCBS Putative arginyl-tRNA--protein transferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ate PE=3 SV=1 38 296 1.0E-07
sp|A1U1G9|ATE_MARHV Putative arginyl-tRNA--protein transferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ate PE=3 SV=1 43 292 1.0E-07
sp|A1W7D8|ATE_ACISJ Putative arginyl-tRNA--protein transferase OS=Acidovorax sp. (strain JS42) GN=ate PE=3 SV=1 44 292 2.0E-07
sp|B9MJA6|ATE_ACIET Putative arginyl-tRNA--protein transferase OS=Acidovorax ebreus (strain TPSY) GN=ate PE=3 SV=1 44 292 2.0E-07
sp|A6T105|ATE_JANMA Putative arginyl-tRNA--protein transferase OS=Janthinobacterium sp. (strain Marseille) GN=ate PE=3 SV=1 44 292 2.0E-07
sp|Q8DAR7|ATE_VIBVU Putative arginyl-tRNA--protein transferase OS=Vibrio vulnificus (strain CMCP6) GN=ate PE=3 SV=2 223 290 3.0E-07
sp|A4SNL5|ATE_AERS4 Putative arginyl-tRNA--protein transferase OS=Aeromonas salmonicida (strain A449) GN=ate PE=3 SV=1 218 293 3.0E-07
sp|Q1QUS3|ATE_CHRSD Putative arginyl-tRNA--protein transferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ate PE=3 SV=1 52 297 4.0E-07
sp|Q7MJ43|ATE_VIBVY Putative arginyl-tRNA--protein transferase OS=Vibrio vulnificus (strain YJ016) GN=ate PE=3 SV=1 223 290 5.0E-07
sp|C5BIJ7|ATE_TERTT Putative arginyl-tRNA--protein transferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ate PE=3 SV=1 149 307 5.0E-07
sp|A6X1Z7|ATE_OCHA4 Putative arginyl-tRNA--protein transferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ate PE=3 SV=1 220 298 5.0E-07
sp|A0KJD9|ATE_AERHH Putative arginyl-tRNA--protein transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ate PE=3 SV=1 218 293 5.0E-07
sp|B3PL52|ATE_CELJU Putative arginyl-tRNA--protein transferase OS=Cellvibrio japonicus (strain Ueda107) GN=ate PE=3 SV=1 218 292 6.0E-07
sp|B2JKL8|ATE_BURP8 Putative arginyl-tRNA--protein transferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ate PE=3 SV=1 44 307 6.0E-07
sp|A5F7F2|ATE_VIBC3 Putative arginyl-tRNA--protein transferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ate PE=3 SV=1 223 292 6.0E-07
sp|C3LN58|ATE_VIBCM Putative arginyl-tRNA--protein transferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ate PE=3 SV=1 223 292 7.0E-07
sp|Q9KRA6|ATE_VIBCH Putative arginyl-tRNA--protein transferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ate PE=3 SV=1 223 292 7.0E-07
sp|B0CL81|ATE_BRUSI Putative arginyl-tRNA--protein transferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ate PE=3 SV=1 207 298 8.0E-07
sp|A8HXU1|ATE_AZOC5 Putative arginyl-tRNA--protein transferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ate PE=3 SV=1 218 308 9.0E-07
sp|P63647|ATE_BRUSU Putative arginyl-tRNA--protein transferase OS=Brucella suis biovar 1 (strain 1330) GN=ate PE=3 SV=1 207 298 9.0E-07
sp|A5VPT9|ATE_BRUO2 Putative arginyl-tRNA--protein transferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ate PE=3 SV=1 207 298 9.0E-07
sp|P63646|ATE_BRUME Putative arginyl-tRNA--protein transferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ate PE=3 SV=1 207 298 9.0E-07
sp|A9MAD7|ATE_BRUC2 Putative arginyl-tRNA--protein transferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ate PE=3 SV=1 207 298 9.0E-07
sp|C0RI93|ATE_BRUMB Putative arginyl-tRNA--protein transferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ate PE=3 SV=1 207 298 9.0E-07
sp|Q57DZ4|ATE_BRUAB Putative arginyl-tRNA--protein transferase OS=Brucella abortus biovar 1 (strain 9-941) GN=ate PE=3 SV=1 207 298 2.0E-06
sp|Q2YNA4|ATE_BRUA2 Putative arginyl-tRNA--protein transferase OS=Brucella abortus (strain 2308) GN=ate PE=3 SV=1 207 298 2.0E-06
sp|B2S504|ATE_BRUA1 Putative arginyl-tRNA--protein transferase OS=Brucella abortus (strain S19) GN=ate PE=3 SV=1 207 298 2.0E-06
sp|Q472J5|ATE_CUPPJ Putative arginyl-tRNA--protein transferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ate PE=3 SV=1 44 296 2.0E-06
sp|Q2SJK9|ATE_HAHCH Putative arginyl-tRNA--protein transferase OS=Hahella chejuensis (strain KCTC 2396) GN=ate PE=3 SV=1 149 296 2.0E-06
sp|Q11JA2|ATE_CHESB Putative arginyl-tRNA--protein transferase OS=Chelativorans sp. (strain BNC1) GN=ate PE=3 SV=1 220 298 3.0E-06
sp|Q15TA0|ATE_PSEA6 Putative arginyl-tRNA--protein transferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=ate PE=3 SV=1 219 292 3.0E-06
sp|B1XV76|ATE_POLNS Putative arginyl-tRNA--protein transferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ate PE=3 SV=1 44 292 3.0E-06
sp|A0KW19|ATE_SHESA Putative arginyl-tRNA--protein transferase OS=Shewanella sp. (strain ANA-3) GN=ate PE=3 SV=1 38 298 3.0E-06
sp|A7INB9|ATE_XANP2 Putative arginyl-tRNA--protein transferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=ate PE=3 SV=1 218 298 4.0E-06
sp|O96539|ATE1_DROME Arginyl-tRNA--protein transferase 1 OS=Drosophila melanogaster GN=Ate1 PE=2 SV=3 44 98 5.0E-06
sp|Q5P1A8|ATE_AROAE Putative arginyl-tRNA--protein transferase OS=Aromatoleum aromaticum (strain EbN1) GN=ate PE=3 SV=1 44 292 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016598 protein arginylation Yes
GO:0004057 arginyltransferase activity Yes
GO:0016740 transferase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016746 acyltransferase activity No
GO:0016755 aminoacyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0019538 protein metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0043412 macromolecule modification No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3355
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1618
Ophiocordyceps australis map64 (Brazil) OphauB2|6747
Ophiocordyceps camponoti-floridani Ophcf2|06726
Ophiocordyceps camponoti-rufipedis Ophun1|467 (this protein)
Ophiocordyceps kimflemingae Ophio5|898
Ophiocordyceps subramaniannii Hirsu2|6241

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|467
MRLLLWQGVIFFDESVASCRRMKLNELPGFSYYAKATSMSPAFYQTMINRCWRRSGKLLYRPNPRHACCPHYTLR
LDANQFKPSRDQRQTVNRFNRYILGDSYIKEAARLFPRSKAETKRRNNEFQLTERLHEAEYDGLGKPPEPAHKLT
VTLEDNIFTEEKYLVYENYQRVVHKEDEKQIGRRSFERFLCASPLRRGTVVGADGRRRRLGSYHQCYRVDGVLVA
VGVLDLLPDSVSSVYFFYHEMMHEHTPGKLGAMFEISLALEEGYRWWYSGFYIHSCPKMRYKMDFSPQYILDPVA
LTWDVLDETVLRLLDRKPFVSLFLERQAAASGHDLMDTADSGFDASPTMDQMRDGSDEDEDRLPLLASDMPGIPS
VAEMEGVDLDHVGIVFNEAAGPLFRTGQTSRWHAESVRDWPSFRAAVAELAAALGPDLVGSFCVDLTRG*
Coding >Ophun1|467
ATGCGGCTACTGCTCTGGCAAGGCGTCATCTTCTTCGACGAATCCGTGGCCAGCTGTCGCAGAATGAAGCTCAAC
GAGCTTCCAGGCTTTTCCTACTACGCAAAGGCAACGTCCATGAGCCCCGCCTTTTATCAAACAATGATCAATCGC
TGTTGGAGACGTTCTGGGAAACTCCTGTATCGACCGAATCCGCGCCACGCCTGCTGTCCTCATTACACGCTTCGA
TTAGACGCGAACCAGTTCAAGCCCTCGAGGGATCAGCGACAGACCGTCAACCGGTTCAACAGATACATCCTTGGC
GACTCATACATCAAAGAAGCTGCTCGGCTGTTTCCGCGCTCCAAGGCAGAGACTAAGAGACGGAACAACGAGTTC
CAGCTTACTGAGCGCCTTCACGAAGCCGAGTATGACGGCCTCGGAAAACCACCGGAGCCCGCTCACAAGTTGACC
GTCACTCTCGAAGACAACATATTCACCGAGGAAAAATACCTCGTGTACGAAAACTACCAAAGGGTCGTCCATAAA
GAAGATGAAAAGCAAATAGGTCGACGTTCATTCGAGCGCTTTCTCTGCGCCTCGCCGCTAAGACGTGGAACCGTT
GTCGGTGCGGATGGGCGCAGACGTCGGCTGGGCTCGTACCATCAATGCTACCGTGTCGATGGCGTTCTGGTCGCG
GTCGGCGTCTTGGATCTCCTCCCGGACAGTGTAAGCTCCGTCTACTTTTTCTATCACGAGATGATGCATGAGCAC
ACGCCTGGCAAGCTGGGCGCCATGTTCGAGATTTCTCTGGCCTTGGAAGAGGGATACCGCTGGTGGTACTCGGGC
TTCTACATCCACAGCTGCCCCAAGATGAGATACAAGATGGACTTTTCGCCGCAGTACATACTCGATCCCGTGGCT
CTGACTTGGGATGTGCTGGATGAGACTGTTTTGAGGCTTCTTGATCGGAAACCGTTCGTCAGCTTGTTTCTGGAA
AGACAGGCCGCGGCTAGCGGTCATGATCTCATGGATACGGCAGACAGTGGCTTCGACGCCAGTCCGACCATGGAC
CAGATGAGAGATGGCAGCGACGAAGACGAGGACCGGCTACCTCTGTTGGCGTCGGACATGCCGGGAATACCCTCG
GTGGCAGAGATGGAAGGGGTCGACCTGGACCACGTAGGCATCGTGTTCAACGAAGCGGCGGGGCCCCTGTTCCGG
ACGGGCCAGACGTCGAGATGGCACGCGGAGTCAGTGAGGGACTGGCCGTCTTTCCGAGCTGCAGTCGCGGAACTG
GCGGCCGCTCTGGGTCCAGACCTGGTGGGCTCGTTTTGCGTGGATTTGACGCGGGGGTGA
Transcript >Ophun1|467
ATGCGGCTACTGCTCTGGCAAGGCGTCATCTTCTTCGACGAATCCGTGGCCAGCTGTCGCAGAATGAAGCTCAAC
GAGCTTCCAGGCTTTTCCTACTACGCAAAGGCAACGTCCATGAGCCCCGCCTTTTATCAAACAATGATCAATCGC
TGTTGGAGACGTTCTGGGAAACTCCTGTATCGACCGAATCCGCGCCACGCCTGCTGTCCTCATTACACGCTTCGA
TTAGACGCGAACCAGTTCAAGCCCTCGAGGGATCAGCGACAGACCGTCAACCGGTTCAACAGATACATCCTTGGC
GACTCATACATCAAAGAAGCTGCTCGGCTGTTTCCGCGCTCCAAGGCAGAGACTAAGAGACGGAACAACGAGTTC
CAGCTTACTGAGCGCCTTCACGAAGCCGAGTATGACGGCCTCGGAAAACCACCGGAGCCCGCTCACAAGTTGACC
GTCACTCTCGAAGACAACATATTCACCGAGGAAAAATACCTCGTGTACGAAAACTACCAAAGGGTCGTCCATAAA
GAAGATGAAAAGCAAATAGGTCGACGTTCATTCGAGCGCTTTCTCTGCGCCTCGCCGCTAAGACGTGGAACCGTT
GTCGGTGCGGATGGGCGCAGACGTCGGCTGGGCTCGTACCATCAATGCTACCGTGTCGATGGCGTTCTGGTCGCG
GTCGGCGTCTTGGATCTCCTCCCGGACAGTGTAAGCTCCGTCTACTTTTTCTATCACGAGATGATGCATGAGCAC
ACGCCTGGCAAGCTGGGCGCCATGTTCGAGATTTCTCTGGCCTTGGAAGAGGGATACCGCTGGTGGTACTCGGGC
TTCTACATCCACAGCTGCCCCAAGATGAGATACAAGATGGACTTTTCGCCGCAGTACATACTCGATCCCGTGGCT
CTGACTTGGGATGTGCTGGATGAGACTGTTTTGAGGCTTCTTGATCGGAAACCGTTCGTCAGCTTGTTTCTGGAA
AGACAGGCCGCGGCTAGCGGTCATGATCTCATGGATACGGCAGACAGTGGCTTCGACGCCAGTCCGACCATGGAC
CAGATGAGAGATGGCAGCGACGAAGACGAGGACCGGCTACCTCTGTTGGCGTCGGACATGCCGGGAATACCCTCG
GTGGCAGAGATGGAAGGGGTCGACCTGGACCACGTAGGCATCGTGTTCAACGAAGCGGCGGGGCCCCTGTTCCGG
ACGGGCCAGACGTCGAGATGGCACGCGGAGTCAGTGAGGGACTGGCCGTCTTTCCGAGCTGCAGTCGCGGAACTG
GCGGCCGCTCTGGGTCCAGACCTGGTGGGCTCGTTTTGCGTGGATTTGACGCGGGGGTGA
Gene >Ophun1|467
ATGCGGCTACTGCTCTGGCAAGGCGTCATCTTCTTCGACGAATCGTGAGTGTCGCTCGTCTTCCAACACCCTCAC
GGGACTCAGTCCTTCGTAACTGGTCTCGTCCCCGCTGAGGCTACCCCCAACGGCAAGCGTGGCCAGCTGTCGCAG
AATGAAGCTCAACGAGCTTCCAGGCTTTTCCTACTACGCAAAGGCAACGTCCATGAGCCCCGCCTTTTATCAAAC
AATGATCAATCGCTGTTGGAGACGTTCTGGGAAACTCCTGTATCGACCGAATCCGCGCCACGCCTGCTGTCCTCA
TTACACGCTTCGATTAGACGCGAACCAGTTCAAGCCCTCGAGGGATCAGCGACAGACCGTCAACCGGTTCAACAG
ATACATCCTTGGCGACTCATACATCAAAGAAGCTGCTCGGCTGTTTCCGCGCTCCAAGGCAGAGACTAAGAGACG
GAACAACGAGTTCCAGCTTACTGAGCGCCTTCACGAAGCCGAGTATGACGGCCTCGGAAAACCACCGGAGCCCGC
TCACAAGTTGACCGTCACTCTCGAAGACAACATATTCACCGAGGAAAAATACCTCGTGTACGAAAACTACCAAAG
GGTCGTCCATAAAGAAGATGAAAAGCAAATAGGTCGACGTTCATTCGAGCGCTTTCTCTGCGCCTCGCCGCTAAG
ACGTGGAACCGTTGTCGGTGCGGATGGGCGCAGACGTCGGCTGGGCTCGTACCATCAATGCTACCGTGTCGATGG
CGTTCTGGTCGCGGTCGGCGTCTTGGATCTCCTCCCGGACAGTGTAAGCTCCGTCTACTTTTTCTATCACGAGAT
GATGCATGAGCACACGCCTGGCAAGCTGGGCGCCATGTTCGAGATTTCTCTGGCCTTGGAAGAGGGATACCGCTG
GTGGTACTCGGGCTTCTACATCCACAGCTGCCCCAAGATGAGATACAAGATGGACTTTTCGCCGCAGTACATACT
CGATCCCGTGGCTCTGACTTGGGATGTGCTGGATGAGACTGTTTTGAGGCTTCTTGATCGGAAACCGTTCGTCAG
CTTGTTTCTGGAAAGACAGGCCGCGGCTAGCGGTCATGATCTCATGGATACGGCAGACAGTGGCTTCGACGCCAG
TCCGACCATGGACCAGATGAGAGATGGCAGCGACGAAGACGAGGACCGGCTACCTCTGTTGGCGTCGGACATGCC
GGGAATACCCTCGGTGGCAGAGATGGAAGGGGTCGACCTGGACCACGTAGGCATCGTGTTCAACGAAGCGGCGGG
GCCCCTGTTCCGGACGGGCCAGACGTCGAGATGGCACGCGGAGTCAGTGAGGGACTGGCCGTCTTTCCGAGCTGC
AGTCGCGGAACTGGCGGCCGCTCTGGGTCCAGACCTGGTGGGCTCGTTTTGCGTGGATTTGACGCGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail