Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4669
Gene name
LocationContig_436:4450..7263
Strand-
Gene length (bp)2813
Transcript length (bp)2607
Coding sequence length (bp)2607
Protein length (aa) 869

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 9.2E-83 250 630

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 98 817 1.0E-179
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 98 817 4.0E-179
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 98 817 4.0E-179
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 98 817 4.0E-179
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 98 817 4.0E-179
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 98 817 1.0E-179
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 98 817 4.0E-179
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 98 817 4.0E-179
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 98 817 4.0E-179
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 98 817 4.0E-179
sp|Q61418|CLCN4_MOUSE H(+)/Cl(-) exchange transporter 4 OS=Mus musculus GN=Clcn4 PE=2 SV=2 90 817 2.0E-172
sp|P51793|CLCN4_HUMAN H(+)/Cl(-) exchange transporter 4 OS=Homo sapiens GN=CLCN4 PE=1 SV=2 98 817 2.0E-172
sp|Q9TTU3|CLCN5_RABIT H(+)/Cl(-) exchange transporter 5 OS=Oryctolagus cuniculus GN=CLCN5 PE=2 SV=1 98 817 3.0E-172
sp|Q5RDJ7|CLCN3_PONAB H(+)/Cl(-) exchange transporter 3 OS=Pongo abelii GN=CLCN3 PE=2 SV=1 98 817 2.0E-171
sp|P51794|CLCN4_RAT H(+)/Cl(-) exchange transporter 4 OS=Rattus norvegicus GN=Clcn4 PE=2 SV=1 98 817 2.0E-171
sp|Q99P66|CLCN5_CAVPO H(+)/Cl(-) exchange transporter 5 OS=Cavia porcellus GN=CLCN5 PE=2 SV=1 90 817 7.0E-170
sp|Q9GKE7|CLCN5_PIG H(+)/Cl(-) exchange transporter 5 OS=Sus scrofa GN=CLCN5 PE=2 SV=1 98 817 4.0E-166
sp|P51796|CLCN5_RAT H(+)/Cl(-) exchange transporter 5 OS=Rattus norvegicus GN=Clcn5 PE=2 SV=1 98 817 5.0E-166
sp|Q5RBK4|CLCN5_PONAB H(+)/Cl(-) exchange transporter 5 OS=Pongo abelii GN=CLCN5 PE=2 SV=1 98 817 6.0E-166
sp|P51795|CLCN5_HUMAN H(+)/Cl(-) exchange transporter 5 OS=Homo sapiens GN=CLCN5 PE=1 SV=1 98 817 6.0E-166
sp|Q9WVD4|CLCN5_MOUSE H(+)/Cl(-) exchange transporter 5 OS=Mus musculus GN=Clcn5 PE=1 SV=1 98 817 1.0E-165
sp|P0C197|CLCNX_USTMA Probable chloride channel protein UM03490-D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11084 PE=3 SV=1 249 747 2.0E-124
sp|O60159|YHYB_SCHPO Putative anion/proton exchange transporter C19C7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C7.11 PE=3 SV=2 97 804 2.0E-116
sp|P37020|GEF1_YEAST Anion/proton exchange transporter GEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEF1 PE=1 SV=2 130 804 1.0E-85
sp|O94287|YOO2_SCHPO Uncharacterized chloride channel protein C887.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.02 PE=3 SV=2 221 804 8.0E-65
sp|Q75JF3|CLCC_DICDI Chloride channel protein C OS=Dictyostelium discoideum GN=clcC PE=3 SV=1 202 805 1.0E-53
sp|Q54C67|CLCF_DICDI Chloride channel protein F OS=Dictyostelium discoideum GN=clcF PE=3 SV=1 247 733 9.0E-53
sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidopsis thaliana GN=CLC-D PE=1 SV=2 245 810 1.0E-50
sp|Q9BMK9|CLH3_CAEEL Chloride channel protein clh-3 OS=Caenorhabditis elegans GN=clh-3 PE=1 SV=1 247 719 1.0E-49
sp|P51799|CLCN7_RAT H(+)/Cl(-) exchange transporter 7 OS=Rattus norvegicus GN=Clcn7 PE=2 SV=1 267 804 2.0E-49
sp|O70496|CLCN7_MOUSE H(+)/Cl(-) exchange transporter 7 OS=Mus musculus GN=Clcn7 PE=1 SV=1 267 804 5.0E-49
sp|P35525|CLCN2_RAT Chloride channel protein 2 OS=Rattus norvegicus GN=Clcn2 PE=1 SV=1 247 719 4.0E-48
sp|P35524|CLCN1_RAT Chloride channel protein 1 OS=Rattus norvegicus GN=Clcn1 PE=1 SV=1 253 720 8.0E-48
sp|Q9WU45|CLCN2_CAVPO Chloride channel protein 2 OS=Cavia porcellus GN=CLCN2 PE=2 SV=1 247 719 1.0E-47
sp|P51788|CLCN2_HUMAN Chloride channel protein 2 OS=Homo sapiens GN=CLCN2 PE=1 SV=2 247 719 3.0E-47
sp|Q9VGH7|CLCN2_DROME Chloride channel protein 2 OS=Drosophila melanogaster GN=ClC-a PE=2 SV=3 247 719 4.0E-47
sp|P51789|CLCN2_RABIT Chloride channel protein 2 OS=Oryctolagus cuniculus GN=CLCN2 PE=2 SV=1 247 719 4.0E-47
sp|Q64347|CLCN1_MOUSE Chloride channel protein 1 OS=Mus musculus GN=Clcn1 PE=1 SV=3 253 720 5.0E-47
sp|P35523|CLCN1_HUMAN Chloride channel protein 1 OS=Homo sapiens GN=CLCN1 PE=1 SV=3 247 733 7.0E-47
sp|Q9R0A1|CLCN2_MOUSE Chloride channel protein 2 OS=Mus musculus GN=Clcn2 PE=1 SV=2 247 719 1.0E-46
sp|Q4PKH3|CLCN7_BOVIN H(+)/Cl(-) exchange transporter 7 OS=Bos taurus GN=CLCN7 PE=2 SV=1 267 804 2.0E-46
sp|Q86AZ6|CLCB_DICDI Chloride channel protein B OS=Dictyostelium discoideum GN=clcB PE=3 SV=1 100 804 2.0E-46
sp|P35522|CICH_TORCA Chloride channel protein OS=Torpedo californica PE=1 SV=3 253 720 1.0E-45
sp|P21564|CICH_TORMA Chloride channel protein OS=Torpedo marmorata PE=1 SV=1 247 720 3.0E-45
sp|Q9MZT1|CLCN1_CANLF Chloride channel protein 1 OS=Canis lupus familiaris GN=CLCN1 PE=1 SV=1 247 733 2.0E-44
sp|P92941|CLCA_ARATH Chloride channel protein CLC-a OS=Arabidopsis thaliana GN=CLC-A PE=1 SV=2 249 804 1.0E-43
sp|P51798|CLCN7_HUMAN H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens GN=CLCN7 PE=1 SV=2 267 804 1.0E-43
sp|Q54AX6|CLCA_DICDI Chloride channel protein A OS=Dictyostelium discoideum GN=clcA PE=2 SV=1 216 804 2.0E-43
sp|P92942|CLCB_ARATH Chloride channel protein CLC-b OS=Arabidopsis thaliana GN=CLC-B PE=1 SV=1 249 804 3.0E-43
sp|O35454|CLCN6_MOUSE Chloride transport protein 6 OS=Mus musculus GN=Clcn6 PE=1 SV=1 246 705 7.0E-40
sp|Q9TT16|CLCN6_RABIT Chloride transport protein 6 OS=Oryctolagus cuniculus GN=CLCN6 PE=2 SV=1 246 705 4.0E-39
sp|P51797|CLCN6_HUMAN Chloride transport protein 6 OS=Homo sapiens GN=CLCN6 PE=1 SV=2 246 705 2.0E-38
sp|Q9W701|CLCKB_XENLA Chloride channel protein ClC-Kb OS=Xenopus laevis GN=clcnkb PE=1 SV=1 258 804 2.0E-38
sp|Q54LQ4|CLCE_DICDI Chloride channel protein E OS=Dictyostelium discoideum GN=clcE PE=3 SV=1 249 721 2.0E-37
sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidopsis thaliana GN=CLC-C PE=1 SV=1 246 803 4.0E-35
sp|P51803|CLCKA_RABIT Chloride channel protein ClC-Ka OS=Oryctolagus cuniculus GN=CLCNKA PE=2 SV=1 267 800 2.0E-27
sp|P51804|CLCKB_RABIT Chloride channel protein ClC-Kb OS=Oryctolagus cuniculus GN=CLCNKB PE=2 SV=1 267 793 2.0E-27
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 525 804 1.0E-26
sp|P51800|CLCKA_HUMAN Chloride channel protein ClC-Ka OS=Homo sapiens GN=CLCNKA PE=1 SV=1 267 800 9.0E-26
sp|Q9WUB6|CLCKB_MOUSE Chloride channel protein ClC-Kb OS=Mus musculus GN=Clcnkb PE=1 SV=2 267 793 2.0E-25
sp|Q06393|CLCKA_RAT Chloride channel protein ClC-Ka OS=Rattus norvegicus GN=Clcnka PE=1 SV=3 267 797 3.0E-25
sp|Q9WUB7|CLCKA_MOUSE Chloride channel protein ClC-Ka OS=Mus musculus GN=Clcnka PE=1 SV=2 267 797 2.0E-24
sp|P51802|CLCKB_RAT Chloride channel protein ClC-Kb OS=Rattus norvegicus GN=Clcnkb PE=1 SV=1 267 727 4.0E-24
sp|P51801|CLCKB_HUMAN Chloride channel protein ClC-Kb OS=Homo sapiens GN=CLCNKB PE=1 SV=3 267 800 9.0E-22
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 249 449 8.0E-20
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2 246 394 2.0E-17
sp|B5Y1L4|CLCA_KLEP3 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae (strain 342) GN=clcA PE=3 SV=1 249 644 4.0E-17
sp|A6T4V9|CLCA_KLEP7 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=clcA PE=3 SV=1 249 644 4.0E-16
sp|A8ALD3|CLCA_CITK8 H(+)/Cl(-) exchange transporter ClcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clcA PE=3 SV=1 249 630 3.0E-15
sp|B5BL83|CLCA_SALPK H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain AKU_12601) GN=clcA PE=3 SV=1 249 630 2.0E-14
sp|Q5PD50|CLCA_SALPA H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clcA PE=3 SV=1 249 630 2.0E-14
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2 525 803 1.0E-13
sp|B4TK31|CLCA_SALHS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella heidelberg (strain SL476) GN=clcA PE=3 SV=1 249 630 2.0E-13
sp|B5FJ02|CLCA_SALDC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella dublin (strain CT_02021853) GN=clcA PE=3 SV=1 249 630 2.0E-13
sp|B5F8R6|CLCA_SALA4 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella agona (strain SL483) GN=clcA PE=3 SV=1 249 630 2.0E-13
sp|B5RHE1|CLCA_SALG2 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clcA PE=3 SV=1 249 630 2.0E-13
sp|Q8ZRP8|CLCA_SALTY H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clcA PE=1 SV=1 249 630 3.0E-13
sp|B4TXQ7|CLCA_SALSV H(+)/Cl(-) exchange transporter ClcA OS=Salmonella schwarzengrund (strain CVM19633) GN=clcA PE=3 SV=1 249 630 4.0E-13
sp|C0Q5R6|CLCA_SALPC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi C (strain RKS4594) GN=clcA PE=3 SV=1 249 630 5.0E-13
sp|A9N0Q1|CLCA_SALPB H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=clcA PE=3 SV=1 249 630 5.0E-13
sp|B4SUY5|CLCA_SALNS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella newport (strain SL254) GN=clcA PE=3 SV=1 249 630 5.0E-13
sp|B5R3G7|CLCA_SALEP H(+)/Cl(-) exchange transporter ClcA OS=Salmonella enteritidis PT4 (strain P125109) GN=clcA PE=3 SV=1 249 630 5.0E-13
sp|Q57T52|CLCA_SALCH H(+)/Cl(-) exchange transporter ClcA OS=Salmonella choleraesuis (strain SC-B67) GN=clcA PE=3 SV=1 249 630 5.0E-13
sp|Q8Z9B3|CLCA_SALTI H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhi GN=clcA PE=3 SV=1 249 630 5.0E-13
sp|A9MPK6|CLCA_SALAR H(+)/Cl(-) exchange transporter ClcA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clcA PE=3 SV=1 249 630 9.0E-13
sp|Q87GZ9|CLCA_VIBPA H(+)/Cl(-) exchange transporter ClcA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=clcA PE=3 SV=1 238 665 4.0E-12
sp|B2K549|CLCA_YERPB H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=clcA PE=3 SV=1 249 399 5.0E-11
sp|A7FM08|CLCA_YERP3 H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clcA PE=3 SV=1 249 399 5.0E-11
sp|B1JK21|CLCA_YERPY H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=clcA PE=3 SV=1 249 399 5.0E-11
sp|A4TPW7|CLCA_YERPP H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis (strain Pestoides F) GN=clcA PE=3 SV=1 249 399 5.0E-11
sp|Q1CLU6|CLCA_YERPN H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=clcA PE=3 SV=1 249 399 5.0E-11
sp|A9R1E4|CLCA_YERPG H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=clcA PE=3 SV=1 249 399 5.0E-11
sp|Q8ZBM0|CLCA_YERPE H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis GN=clcA PE=3 SV=1 249 399 5.0E-11
sp|Q1C3X2|CLCA_YERPA H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=clcA PE=3 SV=1 249 399 5.0E-11
sp|A7MGR4|CLCA_CROS8 H(+)/Cl(-) exchange transporter ClcA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=clcA PE=3 SV=1 255 630 6.0E-10
sp|Q8XTT4|CLCL_RALSO Putative chloride channel protein ClcB-like OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0020 PE=3 SV=2 291 647 4.0E-09
sp|Q8ZEB3|CLCB_YERPE Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pestis GN=clcB PE=3 SV=2 291 629 4.0E-07
sp|Q9AGD5|CLCB_YERPS Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=clcB PE=3 SV=3 291 629 8.0E-07
sp|A7FHW4|CLCB_YERP3 Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clcB PE=3 SV=1 291 629 8.0E-07
sp|A5F0D5|CLCA_VIBC3 H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=clcA PE=3 SV=1 238 395 1.0E-06
sp|C3LVE3|CLCA_VIBCM H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clcA PE=3 SV=1 238 395 1.0E-06
sp|Q9KM62|CLCA_VIBCH H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clcA PE=3 SV=1 238 395 1.0E-06
sp|C3LVE3|CLCA_VIBCM H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clcA PE=3 SV=1 499 630 4.0E-06
sp|Q9KM62|CLCA_VIBCH H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clcA PE=3 SV=1 499 630 4.0E-06
sp|B2U300|CLCA_SHIB3 H(+)/Cl(-) exchange transporter ClcA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=clcA PE=3 SV=1 249 630 5.0E-06
sp|A8AGW0|CLCB_CITK8 Voltage-gated ClC-type chloride channel ClcB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clcB PE=3 SV=1 291 640 5.0E-06
sp|Q7MDF0|CLCA_VIBVY H(+)/Cl(-) exchange transporter ClcA OS=Vibrio vulnificus (strain YJ016) GN=clcA PE=3 SV=1 251 395 8.0E-06
sp|Q8D6J0|CLCA_VIBVU H(+)/Cl(-) exchange transporter ClcA OS=Vibrio vulnificus (strain CMCP6) GN=clcA PE=3 SV=1 251 395 8.0E-06
sp|Q8GX93|CLCE_ARATH Chloride channel protein CLC-e OS=Arabidopsis thaliana GN=CLC-E PE=2 SV=2 537 636 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006821 chloride transport Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005247 voltage-gated chloride channel activity Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008308 voltage-gated anion channel activity No
GO:0005244 voltage-gated ion channel activity No
GO:0005253 anion channel activity No
GO:0015267 channel activity No
GO:0006820 anion transport No
GO:0008509 anion transmembrane transporter activity No
GO:0051179 localization No
GO:0015108 chloride transmembrane transporter activity No
GO:0005216 ion channel activity No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0022832 voltage-gated channel activity No
GO:0005575 cellular_component No
GO:0022836 gated channel activity No
GO:0003674 molecular_function No
GO:0005254 chloride channel activity No
GO:0008150 biological_process No
GO:0015698 inorganic anion transport No
GO:0022803 passive transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 140 162 22
2 208 230 22
3 284 306 22
4 311 328 17
5 341 363 22
6 413 435 22
7 456 475 19
8 510 532 22
9 539 561 22
10 576 595 19
11 602 624 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4669
MPRAPQSNEASASASMPARLPTVIAVDDRDELDFLGDGQDSNGGDASLPSSPLQSLRPPGDGRLTRRNGSHSPLH
RPNSANAKDVDWQTEGPGRRVGYEDLTAIDWIFEYTKERQRQRVLASNAVGLVGYAQRFLDASQVWVVLILTGLM
VGTVAAAIDITTDWLADLKTGFCSSGPEGGQFYLNKSFCCYGYDQGSKCVGWKPWSDALGVHSTIGKWVVEYFFF
IAFSVRPQHGQSLKLANDRVKVTLAYCAALLVQEYAIHAMHSGIPEIKTVLGGFVIRRFLGTWTLVIKSIGLVLA
VGSGMWLGKEGPLVHVACCCSGLFIKLFSNIRDNEARKREVLSAAAAAGISVAFGSPIGGVLFSLEQLSYYFPDK
TMWQSFVCAMTAAVVLHALDPFRSGNLVLYQTKYSTDWHGFEIVPYALLGVLGGIYGGLFIKANMAVARWKKSRP
WIEGPMTQVVAVALLTAIVNYPNLFMKVQSSELVSNLVADCSKVLDDQIGVCKTGAASAGTVVLLVLAALLGSCL
ATVTFGLQIPAGIILPSMAIGALTGRAAGILMEMWVAGYPALFASCAPDAPCITPGTYAIIGAAAALAGVTRMTV
SIVVIMFELTGALTYVLPIMVAVMISKWVGDAFSRHGIYESWIQLNEYPFLDNSDETNIPDVPASHVMTPIHDLM
VLTATGHTMASLNSMLEMHPYRGFPVVSDTAEATLLGYISRAELSYNIRTASRPPRSLPPETEAFFRHQPLADPI
STLDLRPWMDQTPLTLPSRTSLHLVVSYFQKLGPRYVLLSDRGALQGLLTKKDVWYVLNGADETPRSAAAVASGV
VVGAGDAVAVADPLSVTEEHRGLLRGGDAPGVAMADDDGASIL*
Coding >Ophun1|4669
ATGCCTAGGGCTCCCCAAAGCAACGAAGCCTCGGCCTCGGCCTCTATGCCGGCTCGGCTGCCCACCGTGATCGCA
GTCGATGACCGAGACGAGCTCGACTTCCTGGGCGACGGCCAAGACTCGAACGGAGGGGACGCTTCGCTGCCTTCG
TCACCTCTTCAGTCCCTACGACCCCCGGGCGATGGCCGATTAACGCGGCGGAACGGCTCACACTCGCCGCTGCAC
CGGCCAAACTCGGCCAACGCCAAGGACGTGGACTGGCAGACCGAGGGCCCCGGACGGCGTGTCGGATACGAAGAC
CTGACGGCCATTGACTGGATCTTCGAGTATACCAAGGAGAGGCAGCGCCAGCGCGTGCTGGCTTCCAACGCCGTT
GGACTCGTCGGCTATGCCCAGCGCTTCCTGGATGCCAGCCAGGTGTGGGTCGTGCTGATCCTGACGGGCCTCATG
GTCGGTACCGTCGCTGCCGCCATTGATATCACGACGGATTGGCTGGCCGACCTCAAGACGGGTTTCTGCTCCAGC
GGTCCTGAAGGTGGCCAGTTCTACCTCAACAAGAGCTTCTGCTGCTACGGCTACGACCAGGGTTCCAAGTGCGTT
GGATGGAAGCCGTGGAGCGATGCCCTCGGCGTCCATTCGACTATTGGAAAATGGGTCGTTGAATATTTCTTCTTC
ATTGCCTTTTCGGTACGACCACAACACGGCCAGTCGTTGAAGCTAGCTAATGACCGAGTGAAGGTGACGCTGGCA
TACTGCGCCGCCCTGCTGGTACAGGAGTATGCCATCCACGCCATGCACAGCGGCATACCGGAAATCAAGACGGTC
CTGGGAGGCTTCGTCATCCGCAGGTTTCTCGGCACTTGGACGCTGGTCATCAAGTCCATCGGTCTGGTCCTCGCC
GTCGGCTCCGGCATGTGGCTGGGCAAGGAGGGTCCACTTGTTCACGTCGCTTGTTGCTGCTCAGGGCTCTTTATC
AAGCTCTTTAGCAATATCCGAGATAACGAAGCGCGCAAGCGAGAAGTTCTTTCGGCGGCGGCGGCGGCCGGAATC
TCGGTGGCTTTCGGGTCGCCCATCGGCGGCGTCTTGTTCAGCCTCGAGCAACTGTCGTACTACTTCCCGGACAAG
ACTATGTGGCAGAGCTTCGTCTGCGCCATGACTGCCGCAGTCGTGCTACATGCGCTGGACCCCTTTCGATCCGGC
AACTTGGTGCTCTACCAAACAAAGTACAGCACCGACTGGCACGGCTTCGAGATTGTGCCCTATGCTCTGCTCGGC
GTGCTGGGGGGCATCTACGGCGGCCTCTTCATCAAGGCCAACATGGCAGTGGCGCGTTGGAAAAAGTCACGGCCA
TGGATTGAAGGTCCCATGACGCAGGTGGTGGCCGTGGCGCTGCTGACGGCCATCGTCAACTATCCCAACCTCTTC
ATGAAGGTGCAGTCGTCAGAGCTCGTGTCGAACCTGGTAGCCGACTGCTCCAAAGTGCTCGACGACCAGATCGGC
GTGTGCAAGACGGGCGCCGCCTCAGCCGGAACCGTGGTGCTCCTCGTGCTGGCCGCCCTGCTGGGCTCATGCCTG
GCAACCGTCACCTTTGGCCTCCAGATACCCGCTGGCATCATCCTACCGTCCATGGCCATCGGAGCTCTGACGGGT
CGCGCAGCCGGCATCTTGATGGAGATGTGGGTAGCCGGCTATCCCGCTCTCTTCGCCTCTTGCGCCCCAGACGCT
CCCTGCATCACACCCGGAACCTACGCCATCATCGGAGCGGCGGCCGCCCTCGCAGGAGTCACCCGCATGACCGTC
TCCATCGTCGTCATCATGTTCGAGCTCACAGGCGCCCTGACATACGTGTTGCCCATCATGGTAGCCGTCATGATC
TCCAAATGGGTGGGAGACGCCTTCTCACGCCACGGCATCTACGAATCCTGGATCCAGCTCAACGAATACCCCTTT
CTCGACAACAGCGACGAAACCAACATCCCCGATGTGCCCGCCTCACACGTCATGACACCCATCCACGATCTCATG
GTCCTGACCGCCACAGGCCACACCATGGCCTCCCTAAACTCCATGCTGGAAATGCACCCCTACCGCGGCTTCCCC
GTCGTCTCCGACACAGCAGAAGCCACCCTCCTGGGCTACATCTCCCGCGCCGAGCTCAGCTACAACATCCGAACC
GCCTCAAGACCCCCCCGATCCCTTCCCCCCGAGACGGAGGCCTTCTTCCGCCACCAGCCGCTGGCAGACCCGATC
TCGACTCTCGACCTCCGCCCCTGGATGGACCAGACGCCCCTGACGCTTCCCTCTCGCACAAGCCTGCACCTCGTC
GTCTCGTACTTTCAGAAGCTGGGGCCGCGCTACGTGCTGTTGAGCGATCGCGGCGCTCTGCAGGGGTTGTTGACC
AAGAAGGACGTATGGTACGTTCTCAACGGCGCCGACGAGACGCCCCGTTCCGCCGCCGCAGTCGCTTCCGGTGTC
GTCGTCGGAGCCGGTGATGCTGTGGCCGTGGCGGACCCGCTCTCGGTCACGGAGGAGCATAGAGGTCTGCTTCGA
GGCGGGGACGCGCCGGGCGTGGCCATGGCGGATGATGATGGGGCGTCGATACTTTAG
Transcript >Ophun1|4669
ATGCCTAGGGCTCCCCAAAGCAACGAAGCCTCGGCCTCGGCCTCTATGCCGGCTCGGCTGCCCACCGTGATCGCA
GTCGATGACCGAGACGAGCTCGACTTCCTGGGCGACGGCCAAGACTCGAACGGAGGGGACGCTTCGCTGCCTTCG
TCACCTCTTCAGTCCCTACGACCCCCGGGCGATGGCCGATTAACGCGGCGGAACGGCTCACACTCGCCGCTGCAC
CGGCCAAACTCGGCCAACGCCAAGGACGTGGACTGGCAGACCGAGGGCCCCGGACGGCGTGTCGGATACGAAGAC
CTGACGGCCATTGACTGGATCTTCGAGTATACCAAGGAGAGGCAGCGCCAGCGCGTGCTGGCTTCCAACGCCGTT
GGACTCGTCGGCTATGCCCAGCGCTTCCTGGATGCCAGCCAGGTGTGGGTCGTGCTGATCCTGACGGGCCTCATG
GTCGGTACCGTCGCTGCCGCCATTGATATCACGACGGATTGGCTGGCCGACCTCAAGACGGGTTTCTGCTCCAGC
GGTCCTGAAGGTGGCCAGTTCTACCTCAACAAGAGCTTCTGCTGCTACGGCTACGACCAGGGTTCCAAGTGCGTT
GGATGGAAGCCGTGGAGCGATGCCCTCGGCGTCCATTCGACTATTGGAAAATGGGTCGTTGAATATTTCTTCTTC
ATTGCCTTTTCGGTACGACCACAACACGGCCAGTCGTTGAAGCTAGCTAATGACCGAGTGAAGGTGACGCTGGCA
TACTGCGCCGCCCTGCTGGTACAGGAGTATGCCATCCACGCCATGCACAGCGGCATACCGGAAATCAAGACGGTC
CTGGGAGGCTTCGTCATCCGCAGGTTTCTCGGCACTTGGACGCTGGTCATCAAGTCCATCGGTCTGGTCCTCGCC
GTCGGCTCCGGCATGTGGCTGGGCAAGGAGGGTCCACTTGTTCACGTCGCTTGTTGCTGCTCAGGGCTCTTTATC
AAGCTCTTTAGCAATATCCGAGATAACGAAGCGCGCAAGCGAGAAGTTCTTTCGGCGGCGGCGGCGGCCGGAATC
TCGGTGGCTTTCGGGTCGCCCATCGGCGGCGTCTTGTTCAGCCTCGAGCAACTGTCGTACTACTTCCCGGACAAG
ACTATGTGGCAGAGCTTCGTCTGCGCCATGACTGCCGCAGTCGTGCTACATGCGCTGGACCCCTTTCGATCCGGC
AACTTGGTGCTCTACCAAACAAAGTACAGCACCGACTGGCACGGCTTCGAGATTGTGCCCTATGCTCTGCTCGGC
GTGCTGGGGGGCATCTACGGCGGCCTCTTCATCAAGGCCAACATGGCAGTGGCGCGTTGGAAAAAGTCACGGCCA
TGGATTGAAGGTCCCATGACGCAGGTGGTGGCCGTGGCGCTGCTGACGGCCATCGTCAACTATCCCAACCTCTTC
ATGAAGGTGCAGTCGTCAGAGCTCGTGTCGAACCTGGTAGCCGACTGCTCCAAAGTGCTCGACGACCAGATCGGC
GTGTGCAAGACGGGCGCCGCCTCAGCCGGAACCGTGGTGCTCCTCGTGCTGGCCGCCCTGCTGGGCTCATGCCTG
GCAACCGTCACCTTTGGCCTCCAGATACCCGCTGGCATCATCCTACCGTCCATGGCCATCGGAGCTCTGACGGGT
CGCGCAGCCGGCATCTTGATGGAGATGTGGGTAGCCGGCTATCCCGCTCTCTTCGCCTCTTGCGCCCCAGACGCT
CCCTGCATCACACCCGGAACCTACGCCATCATCGGAGCGGCGGCCGCCCTCGCAGGAGTCACCCGCATGACCGTC
TCCATCGTCGTCATCATGTTCGAGCTCACAGGCGCCCTGACATACGTGTTGCCCATCATGGTAGCCGTCATGATC
TCCAAATGGGTGGGAGACGCCTTCTCACGCCACGGCATCTACGAATCCTGGATCCAGCTCAACGAATACCCCTTT
CTCGACAACAGCGACGAAACCAACATCCCCGATGTGCCCGCCTCACACGTCATGACACCCATCCACGATCTCATG
GTCCTGACCGCCACAGGCCACACCATGGCCTCCCTAAACTCCATGCTGGAAATGCACCCCTACCGCGGCTTCCCC
GTCGTCTCCGACACAGCAGAAGCCACCCTCCTGGGCTACATCTCCCGCGCCGAGCTCAGCTACAACATCCGAACC
GCCTCAAGACCCCCCCGATCCCTTCCCCCCGAGACGGAGGCCTTCTTCCGCCACCAGCCGCTGGCAGACCCGATC
TCGACTCTCGACCTCCGCCCCTGGATGGACCAGACGCCCCTGACGCTTCCCTCTCGCACAAGCCTGCACCTCGTC
GTCTCGTACTTTCAGAAGCTGGGGCCGCGCTACGTGCTGTTGAGCGATCGCGGCGCTCTGCAGGGGTTGTTGACC
AAGAAGGACGTATGGTACGTTCTCAACGGCGCCGACGAGACGCCCCGTTCCGCCGCCGCAGTCGCTTCCGGTGTC
GTCGTCGGAGCCGGTGATGCTGTGGCCGTGGCGGACCCGCTCTCGGTCACGGAGGAGCATAGAGGTCTGCTTCGA
GGCGGGGACGCGCCGGGCGTGGCCATGGCGGATGATGATGGGGCGTCGATACTTTAG
Gene >Ophun1|4669
ATGCCTAGGGCTCCCCAAAGCAACGAAGCCTCGGCCTCGGCCTCTATGCCGGCTCGGCTGCCCACCGTGATCGCA
GTCGATGACCGAGACGAGCTCGACTTCCTGGGCGACGGCCAAGACTCGAACGGAGGGGACGCTTCGCTGCCTTCG
TCACCTCTTCAGTCCCTACGACCCCCGGGCGATGGCCGATTAACGCGGCGGAACGGCTCACACTCGCCGCTGCAC
CGGCCAAACTCGGCCAACGCCAAGGACGTGGACTGGCAGACCGAGGGCCCCGGACGGCGTGTCGGATACGAAGAC
CTGACGGCCATTGACTGGATCTTCGAGTATACCAAGGAGAGGCAGCGCCAGCGCGTGCTGGCTTCCAACGCCGTT
GGACTCGTCGGCTATGCCCAGCGCTTCCTGGATGCCAGCCAGGTGTGGGTCGTGCTGATCCTGACGGGCCTCATG
GTCGGTACCGTCGCTGCCGCCATTGATATCACGACGGATTGGCTGGCCGACCTCAAGACGGGTTTCTGCTCCAGC
GGTCCTGAAGGTGGCCAGTTCTACCTCAACAAGAGCTTCTGCTGCTACGGCTACGACCAGGGTTCCAAGTGCGTT
GGATGGAAGCCGTGGAGCGATGCCCTCGGCGTCCATTCGACTATTGGAAAATGGGTCGTTGAATATTTCTTCTTC
ATTGCCTTTTCGGTACGACCACAACACGGCCAGTCGTTGAAGCTAGCTAATGACCGAGTGAAGGTGACGCTGGCA
TACTGCGCCGCCCTGCTGGTACAGGAGTATGCCATCCACGCCATGCACAGCGGCATACCGGAAATCAAGACGGTC
CTGGGAGGCTTCGTCATCCGCAGGTTTCTCGGCACTTGGACGCTGGTCATCAAGTCCATCGGTCTGGTAGGATCT
CGCCTCGACTCGTCGGGGGATAGTCGGAGACTGACAGGAGCAGGTCCTCGCCGTCGGCTCCGGCATGTGGCTGGG
CAAGGAGGGTCCACTTGTTCACGTCGCTTGTTGCTGCTCAGGGCTCTTTATCAAGCTCTTTAGCAATATCCGAGA
TAACGAAGGTGAAAGAGGGAGAGTCTTTCGCCTGAAGCTGGGCTGATGAGAAACAGCGCGCAAGCGAGAAGTTCT
TTCGGCGGCGGCGGCGGCCGGAATCTCGGTGGCTTTCGGGTCGCCCATCGGCGGCGTCTTGTTCAGCCTCGAGGT
ATGTCTCTTGGCTGGGCTGGGCTGGAAGAAGTAAGCTGATGAGGCCCAATCGCAGCAACTGTCGTACTACTTCCC
GGACAAGACTATGTGGCAGAGCTTCGTCTGCGCCATGACTGCCGCAGTCGTGCTACATGCGCTGGACCCCTTTCG
ATCCGGCAACTTGGTGCTCTACCAAACAAAGTACAGCACCGACTGGCACGGCTTCGAGATTGTGCCCTATGCTCT
GCTCGGCGTGCTGGGGGTACGTGTGTCGAGCGAGAGGGATGGACAGCGGCTGACACTCGTCACAGGGCATCTACG
GCGGCCTCTTCATCAAGGCCAACATGGCAGTGGCGCGTTGGAAAAAGTCACGGCCATGGATTGAAGGTCCCATGA
CGCAGGTGGTGGCCGTGGCGCTGCTGACGGCCATCGTCAACTATCCCAACCTCTTCATGAAGGTGCAGTCGTCAG
AGCTCGTGTCGAACCTGGTAGCCGACTGCTCCAAAGTGCTCGACGACCAGATCGGCGTGTGCAAGACGGGCGCCG
CCTCAGCCGGAACCGTGGTGCTCCTCGTGCTGGCCGCCCTGCTGGGCTCATGCCTGGCAACCGTCACCTTTGGCC
TCCAGATACCCGCTGGCATCATCCTACCGTCCATGGCCATCGGAGCTCTGACGGGTCGCGCAGCCGGCATCTTGA
TGGAGATGTGGGTAGCCGGCTATCCCGCTCTCTTCGCCTCTTGCGCCCCAGACGCTCCCTGCATCACACCCGGAA
CCTACGCCATCATCGGAGCGGCGGCCGCCCTCGCAGGAGTCACCCGCATGACCGTCTCCATCGTCGTCATCATGT
TCGAGCTCACAGGCGCCCTGACATACGTGTTGCCCATCATGGTAGCCGTCATGATCTCCAAATGGGTGGGAGACG
CCTTCTCACGCCACGGCATCTACGAATCCTGGATCCAGCTCAACGAATACCCCTTTCTCGACAACAGCGACGAAA
CCAACATCCCCGATGTGCCCGCCTCACACGTCATGACACCCATCCACGATCTCATGGTCCTGACCGCCACAGGCC
ACACCATGGCCTCCCTAAACTCCATGCTGGAAATGCACCCCTACCGCGGCTTCCCCGTCGTCTCCGACACAGCAG
AAGCCACCCTCCTGGGCTACATCTCCCGCGCCGAGCTCAGCTACAACATCCGAACCGCCTCAAGACCCCCCCGAT
CCCTTCCCCCCGAGACGGAGGCCTTCTTCCGCCACCAGCCGCTGGCAGACCCGATCTCGACTCTCGACCTCCGCC
CCTGGATGGACCAGACGCCCCTGACGCTTCCCTCTCGCACAAGCCTGCACCTCGTCGTCTCGTACTTTCAGAAGC
TGGGGCCGCGCTACGTGCTGTTGAGCGATCGCGGCGCTCTGCAGGGGTTGTTGACCAAGAAGGACGTATGGTACG
TTCTCAACGGCGCCGACGAGACGCCCCGTTCCGCCGCCGCAGTCGCTTCCGGTGTCGTCGTCGGAGCCGGTGATG
CTGTGGCCGTGGCGGACCCGCTCTCGGTCACGGAGGAGCATAGAGGTCTGCTTCGAGGCGGGGACGCGCCGGGCG
TGGCCATGGCGGATGATGATGGGGCGTCGATACTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail