Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4668
Gene name
LocationContig_436:2116..4140
Strand-
Gene length (bp)2024
Transcript length (bp)1854
Coding sequence length (bp)1854
Protein length (aa) 618

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05536 Neurochondrin Neurochondrin 1.5E-69 14 498

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3224
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4844
Ophiocordyceps australis map64 (Brazil) OphauB2|6943
Ophiocordyceps camponoti-floridani Ophcf2|01884
Ophiocordyceps camponoti-rufipedis Ophun1|4668 (this protein)
Ophiocordyceps kimflemingae Ophio5|4045
Ophiocordyceps subramaniannii Hirsu2|582

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4668
MDQQQPSQEPTVDAASLANIQSLLRARDDTQRFVGLALLKSVLDNSQQLLQDEAVIQSLWESLSATFLDRLLRTG
SKPANRDAKEMLDLAVSVLRIFAALLPEGSRADASSDETTSLLLQLLHTLVSLPEGARVLVSCQDLSPLTENAPS
HPLALDVLKFAWLNSMADAENGRHLSQRIDVTLQELCSSFTGTDGVTLLEFLGDFLRQADPDILSKDPKWLGKAC
GYIHSLAMSRPTPEARSAYTNAAASILQVYPRLAPRLLFTDDCRAEKAPAYLLMNLLLIDIRSSAPTLLGQLNAP
ESGATTRRLASAFDVVCIFVGFLVQCLDGDGSDALAMSPDSLLKIRKGISDTMSVTIEYLRDRWDASMAGAMGLH
PEARVGNAETATGSHRTLAWDSMANSVDDDPLILSAVRALALWLREDENDLLRKEATGLMDMFMDLYQGSAVGKL
DFRSPILVALEALMELNKGRDLLLRHDGWQILSKDLTDILNDSSDTNDKDAASRGIDIVRVLIHVAEEESTGTPE
AWMDLITTIAAWDVPNRERPPETQEFQLAVLELCCTLLLGAGSGARNRYRHSICAVAGLATRLSRCMAWDGPLAG
AMEDVMSTLNGVVSLGG*
Coding >Ophun1|4668
ATGGACCAGCAGCAGCCCTCTCAGGAACCCACCGTCGACGCCGCCAGCTTGGCCAACATCCAGAGCCTCCTGCGA
GCCCGCGACGACACGCAGAGATTCGTCGGCCTGGCACTGCTCAAGTCGGTTCTCGATAACTCGCAGCAGCTTCTT
CAGGACGAGGCTGTCATCCAGTCGCTATGGGAGAGCCTGTCCGCCACCTTCTTGGACAGGTTGCTGCGCACCGGC
TCGAAACCGGCGAATCGGGATGCCAAGGAAATGCTGGATCTGGCCGTCTCCGTTCTGCGCATTTTTGCGGCTTTG
CTTCCTGAGGGCTCGCGGGCAGATGCCAGTTCCGATGAGACTACCAGCCTCCTGCTGCAGCTCCTCCATACTCTG
GTCAGCTTGCCTGAAGGGGCTCGCGTTCTCGTCAGCTGCCAGGACCTGAGCCCCCTCACCGAGAATGCACCCTCT
CATCCCCTCGCTCTTGATGTCCTCAAGTTCGCGTGGCTCAACAGCATGGCAGATGCGGAGAATGGACGTCATCTT
TCTCAGAGAATTGACGTTACCCTGCAGGAACTTTGCTCGTCCTTTACCGGCACGGATGGTGTTACTTTGCTGGAG
TTTCTAGGAGATTTCCTGCGCCAGGCGGATCCGGATATATTATCCAAAGATCCCAAGTGGCTCGGTAAAGCGTGC
GGTTACATCCACAGTCTTGCCATGAGTCGTCCGACTCCTGAAGCGAGGTCTGCCTACACCAATGCAGCCGCCTCG
ATTCTCCAGGTCTATCCAAGACTGGCTCCGAGGCTTTTGTTTACGGACGATTGTCGCGCAGAAAAGGCCCCCGCC
TATCTGCTCATGAATCTCCTGCTCATCGATATCCGTTCATCCGCGCCGACGCTTCTTGGGCAGCTGAACGCGCCA
GAGAGCGGTGCAACAACCAGACGATTGGCATCGGCATTCGACGTCGTCTGTATCTTTGTGGGATTCCTGGTCCAG
TGCCTCGACGGGGATGGATCTGACGCCTTGGCCATGTCTCCGGACAGTCTTCTCAAGATTCGCAAGGGCATATCA
GACACAATGTCCGTGACGATTGAGTATCTTCGAGATCGGTGGGATGCTTCGATGGCCGGAGCCATGGGCTTGCAT
CCCGAAGCCCGAGTTGGTAACGCCGAGACCGCAACCGGCTCGCACCGAACACTGGCATGGGACTCGATGGCGAAT
TCGGTCGATGACGATCCTTTGATACTGTCTGCCGTCCGCGCGCTGGCTCTCTGGCTGAGAGAAGATGAGAACGAT
CTGTTGCGCAAGGAGGCAACGGGATTGATGGACATGTTCATGGATCTCTACCAAGGGAGCGCCGTGGGAAAACTA
GACTTCAGGTCGCCAATACTCGTTGCGCTGGAGGCCTTGATGGAGCTGAACAAGGGGCGGGATCTCCTCCTTCGT
CACGACGGCTGGCAGATCCTGAGTAAAGATCTGACGGATATACTCAACGACTCATCAGACACCAACGACAAGGAC
GCGGCGTCTCGCGGCATCGACATCGTCCGCGTCCTCATCCACGTCGCAGAAGAGGAATCAACCGGCACGCCAGAG
GCCTGGATGGATCTCATCACCACAATTGCCGCCTGGGACGTTCCCAATCGGGAGCGGCCCCCCGAGACGCAAGAG
TTCCAGCTTGCGGTGCTGGAGCTGTGCTGCACGCTGCTGCTGGGGGCGGGCAGCGGCGCGCGGAACAGATACAGG
CACTCCATCTGCGCAGTCGCGGGCTTAGCAACGCGGCTGAGCCGCTGCATGGCGTGGGATGGCCCCCTGGCTGGG
GCGATGGAGGACGTCATGAGCACCTTGAACGGGGTTGTCTCACTTGGCGGCTAA
Transcript >Ophun1|4668
ATGGACCAGCAGCAGCCCTCTCAGGAACCCACCGTCGACGCCGCCAGCTTGGCCAACATCCAGAGCCTCCTGCGA
GCCCGCGACGACACGCAGAGATTCGTCGGCCTGGCACTGCTCAAGTCGGTTCTCGATAACTCGCAGCAGCTTCTT
CAGGACGAGGCTGTCATCCAGTCGCTATGGGAGAGCCTGTCCGCCACCTTCTTGGACAGGTTGCTGCGCACCGGC
TCGAAACCGGCGAATCGGGATGCCAAGGAAATGCTGGATCTGGCCGTCTCCGTTCTGCGCATTTTTGCGGCTTTG
CTTCCTGAGGGCTCGCGGGCAGATGCCAGTTCCGATGAGACTACCAGCCTCCTGCTGCAGCTCCTCCATACTCTG
GTCAGCTTGCCTGAAGGGGCTCGCGTTCTCGTCAGCTGCCAGGACCTGAGCCCCCTCACCGAGAATGCACCCTCT
CATCCCCTCGCTCTTGATGTCCTCAAGTTCGCGTGGCTCAACAGCATGGCAGATGCGGAGAATGGACGTCATCTT
TCTCAGAGAATTGACGTTACCCTGCAGGAACTTTGCTCGTCCTTTACCGGCACGGATGGTGTTACTTTGCTGGAG
TTTCTAGGAGATTTCCTGCGCCAGGCGGATCCGGATATATTATCCAAAGATCCCAAGTGGCTCGGTAAAGCGTGC
GGTTACATCCACAGTCTTGCCATGAGTCGTCCGACTCCTGAAGCGAGGTCTGCCTACACCAATGCAGCCGCCTCG
ATTCTCCAGGTCTATCCAAGACTGGCTCCGAGGCTTTTGTTTACGGACGATTGTCGCGCAGAAAAGGCCCCCGCC
TATCTGCTCATGAATCTCCTGCTCATCGATATCCGTTCATCCGCGCCGACGCTTCTTGGGCAGCTGAACGCGCCA
GAGAGCGGTGCAACAACCAGACGATTGGCATCGGCATTCGACGTCGTCTGTATCTTTGTGGGATTCCTGGTCCAG
TGCCTCGACGGGGATGGATCTGACGCCTTGGCCATGTCTCCGGACAGTCTTCTCAAGATTCGCAAGGGCATATCA
GACACAATGTCCGTGACGATTGAGTATCTTCGAGATCGGTGGGATGCTTCGATGGCCGGAGCCATGGGCTTGCAT
CCCGAAGCCCGAGTTGGTAACGCCGAGACCGCAACCGGCTCGCACCGAACACTGGCATGGGACTCGATGGCGAAT
TCGGTCGATGACGATCCTTTGATACTGTCTGCCGTCCGCGCGCTGGCTCTCTGGCTGAGAGAAGATGAGAACGAT
CTGTTGCGCAAGGAGGCAACGGGATTGATGGACATGTTCATGGATCTCTACCAAGGGAGCGCCGTGGGAAAACTA
GACTTCAGGTCGCCAATACTCGTTGCGCTGGAGGCCTTGATGGAGCTGAACAAGGGGCGGGATCTCCTCCTTCGT
CACGACGGCTGGCAGATCCTGAGTAAAGATCTGACGGATATACTCAACGACTCATCAGACACCAACGACAAGGAC
GCGGCGTCTCGCGGCATCGACATCGTCCGCGTCCTCATCCACGTCGCAGAAGAGGAATCAACCGGCACGCCAGAG
GCCTGGATGGATCTCATCACCACAATTGCCGCCTGGGACGTTCCCAATCGGGAGCGGCCCCCCGAGACGCAAGAG
TTCCAGCTTGCGGTGCTGGAGCTGTGCTGCACGCTGCTGCTGGGGGCGGGCAGCGGCGCGCGGAACAGATACAGG
CACTCCATCTGCGCAGTCGCGGGCTTAGCAACGCGGCTGAGCCGCTGCATGGCGTGGGATGGCCCCCTGGCTGGG
GCGATGGAGGACGTCATGAGCACCTTGAACGGGGTTGTCTCACTTGGCGGCTAA
Gene >Ophun1|4668
ATGGACCAGCAGCAGCCCTCTCAGGAACCCACCGTCGACGCCGCCAGCTTGGCCAACATCCAGAGCCTCCTGCGA
GCCCGCGACGACACGCAGAGATTCGTCGGCCTGGCACTGCTCAAGTCGGTTCTCGATAACTCGCAGCAGCTTCTT
CAGGACGAGGCTGTCATCCAGTCGCTATGGGAGAGCCTGTCCGCCACCTTCTTGGACAGGTTGCTGCGCACCGGC
TCGAAACCGGCGAATCGGGATGCCAAGGAAATGCTGGATCTGGCCGTCTCCGTTCTGCGCATTTTTGCGGCTTTG
CTTCCTGAGGGCTCGCGGGCAGATGCCAGGTTTACTGGGAGGATACCTGCTCTAGTTGGCGCGGTCCTGTATAGG
TGGGAGGCTTGATTCAACTGTCTGCTCTCATGACTCTCACCTAACCTCGACCGTGCAGTTCCGATGAGACTACCA
GCCTCCTGCTGCAGCTCCTCCATACTCTGGTCAGCTTGCCTGAAGGGGCTCGCGTTCTCGTCAGCTGCCAGGACC
TGAGCCCCCTCACCGAGAATGCACCCTCTCATCCCCTCGCTCTTGATGTCCTCAAGTTCGCGTGGCTCAACAGCA
TGGCAGATGCGGAGAATGGACGTCATCTTTCTCAGAGAATTGACGTTACCCTGCAGGAACTTTGCTCGTCCTTTA
CCGGCACGGATGGTGTTACTTTGCTGGAGTTTCTAGGAGATTTCCTGCGCCAGGCGGATCCGGATGTAGGTCCAC
GCAGTCCTTGCTTTACCATGAACTTCACTTCGTTCCGCCAGGCTAAACTTGCACAGATATTATCCAAAGATCCCA
AGTGGCTCGGTAAAGCGTGCGGTTACATCCACAGTCTTGCCATGAGTCGTCCGACTCCTGAAGCGAGGTCTGCCT
ACACCAATGCAGCCGCCTCGATTCTCCAGGTCTATCCAAGACTGGCTCCGAGGCTTTTGTTTACGGACGATTGTC
GCGCAGAAAAGGCCCCCGCCTATCTGCTCATGAATCTCCTGCTCATCGATATCCGTTCATCCGCGCCGACGCTTC
TTGGGCAGCTGAACGCGCCAGAGAGCGGTGCAACAACCAGACGATTGGCATCGGCATTCGACGTCGTCTGTATCT
TTGTGGGATTCCTGGTCCAGTGCCTCGACGGGGATGGATCTGACGCCTTGGCCATGTCTCCGGACAGTCTTCTCA
AGATTCGCAAGGGCATATCAGACACAATGTCCGTGACGATTGAGTATCTTCGAGATCGGTGGGATGCTTCGATGG
CCGGAGCCATGGGCTTGCATCCCGAAGCCCGAGTTGGTAACGCCGAGACCGCAACCGGCTCGCACCGAACACTGG
CATGGGACTCGATGGCGAATTCGGTCGATGACGATCCTTTGATACTGTCTGCCGTCCGCGCGCTGGCTCTCTGGC
TGAGAGAAGATGAGAACGATCTGTTGCGCAAGGAGGCAACGGGATTGATGGACATGTTCATGGATCTCTACCAAG
GGAGCGCCGTGGGAAAACTAGACTTCAGGTCGCCAATACTCGTTGCGCTGGAGGCCTTGATGGAGCTGAACAAGG
GGCGGGATCTCCTCCTTCGTCACGACGGCTGGCAGATCCTGAGTAAAGATCTGACGGATATACTCAACGACTCAT
CAGACACCAACGACAAGGACGCGGCGTCTCGCGGCATCGACATCGTCCGCGTCCTCATCCACGTCGCAGAAGAGG
AATCAACCGGCACGCCAGAGGCCTGGATGGATCTCATCACCACAATTGCCGCCTGGGACGTTCCCAATCGGGAGC
GGCCCCCCGAGACGCAAGAGTTCCAGCTTGCGGTGCTGGAGCTGTGCTGCACGCTGCTGCTGGGGGCGGGCAGCG
GCGCGCGGAACAGATACAGGCACTCCATCTGCGCAGTCGCGGGCTTAGCAACGCGGCTGAGCCGCTGCATGGCGT
GGGATGGCCCCCTGGCTGGGGCGATGGAGGACGTCATGAGCACCTTGAACGGGGTTGTCTCACTTGGCGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail