Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4656
Gene name
LocationContig_434:414..2084
Strand-
Gene length (bp)1670
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 3.1E-08 125 158
PF12937 F-box-like F-box-like 7.1E-06 126 158

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1248
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4041
Ophiocordyceps australis map64 (Brazil) OphauB2|530
Ophiocordyceps camponoti-floridani Ophcf2|00127
Ophiocordyceps camponoti-rufipedis Ophun1|4656 (this protein)
Ophiocordyceps kimflemingae Ophio5|3815
Ophiocordyceps subramaniannii Hirsu2|10461

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4656
MAQQRPLVAMDPPHITEFASERYFEKLHQLNASQPQQQPEPFASPAPASTTFFLPLREARLPDPDAFKPADLKRD
KPRFFSLPFKDRRPSTKLPTSPHHESPHASNPRLSTDSAAKSLALGQLFMSLPNELQIQIVSSLPLTDVLNLRLL
SKSWHALVTLNESPIVRYHLDHHIPAYALRLYPLSVPSDGTFHHLCSLWHRLHVAAKLAFLMCEWITKEIFLRHT
EFQRAAFAPQHERMRRRLIPLLFTIFHFFETHRALHLKRIAEFDGLALRREPYTVNPIERQIFDMYDDQTLLRVH
EVFPLVISSFCRRLRPPTYVGRVERSLRGYLRERPTDEVHAAVLCIGGLRQVERLWEIKGYNSRRASVDAWYQAL
SKDHAVESCTAKLRLGLKGFGRKRPAASARPSSREGWPNTNRAKTSSDLSDPTHAEASSESNWVFCTSLAADMPM
ALPSKEHAQLILDDLPGLKHIWMVTAEATILQRGIVPRTQDIKRNQQVMLDLIREDGMGEEDEWWYGRNIPDSIR
PTRGAADDEADCS*
Coding >Ophun1|4656
ATGGCCCAGCAACGTCCGCTCGTCGCCATGGACCCTCCTCACATTACCGAATTCGCCTCGGAGCGCTACTTCGAA
AAGCTCCATCAGCTAAACGCCAGCCAGCCTCAGCAACAACCCGAGCCCTTCGCATCTCCCGCTCCGGCTTCTACC
ACTTTCTTTCTCCCGCTCCGCGAGGCCAGGCTGCCCGACCCCGACGCCTTCAAGCCCGCTGACCTGAAGCGTGAC
AAACCTCGCTTCTTCTCCCTACCTTTCAAGGATAGGCGCCCGTCTACAAAGCTGCCGACGAGTCCTCATCATGAG
TCTCCTCACGCATCGAACCCGAGGCTGTCAACCGACTCCGCTGCCAAGAGCCTTGCTTTGGGCCAGCTCTTCATG
TCTTTGCCCAACGAGCTGCAGATTCAGATCGTTTCGTCGCTCCCCTTGACAGACGTCCTCAACCTGCGGCTTCTC
TCCAAGTCGTGGCATGCTCTCGTCACACTCAACGAGTCCCCCATTGTTCGATACCATCTCGATCACCACATTCCC
GCCTACGCCCTCCGCCTCTACCCCTTATCGGTGCCCAGCGACGGCACCTTTCACCACCTCTGCAGCCTGTGGCAC
CGTCTTCATGTCGCCGCCAAGCTGGCCTTTCTCATGTGCGAATGGATCACCAAGGAGATCTTTTTGCGACACACC
GAGTTTCAACGCGCTGCGTTCGCGCCCCAGCACGAGCGCATGCGCCGTCGCCTCATCCCCCTTCTCTTCACCATC
TTTCACTTCTTCGAGACCCATCGAGCTCTTCACCTGAAACGCATCGCCGAATTCGACGGTCTCGCCCTCCGGAGG
GAGCCCTACACCGTCAATCCCATTGAGCGACAGATCTTTGACATGTACGACGACCAGACCCTGTTGAGGGTCCAC
GAGGTCTTCCCCCTCGTCATCTCATCCTTCTGCCGCCGCTTGCGACCGCCCACCTACGTCGGACGGGTAGAGCGA
TCCCTCCGCGGCTATCTCCGGGAGCGGCCCACCGACGAGGTCCACGCCGCCGTCCTTTGCATCGGGGGCCTCCGC
CAGGTCGAGAGGCTGTGGGAGATCAAGGGCTACAACAGCCGTCGAGCCTCCGTCGACGCCTGGTATCAAGCCCTG
TCCAAGGATCATGCCGTCGAGTCGTGCACCGCCAAGCTGCGCCTCGGCTTGAAGGGTTTCGGACGCAAGAGGCCC
GCCGCCTCCGCCCGGCCGTCGTCACGCGAGGGCTGGCCGAACACGAACAGAGCAAAGACATCGTCGGACCTGTCG
GACCCGACCCACGCCGAGGCCTCGTCCGAGTCCAACTGGGTCTTCTGCACCAGTCTGGCGGCCGACATGCCCATG
GCGCTCCCGTCCAAGGAGCACGCCCAGCTCATCCTCGACGACCTGCCCGGCCTCAAGCACATCTGGATGGTCACG
GCGGAGGCCACCATCCTGCAACGCGGCATAGTCCCCCGCACGCAGGACATTAAGCGGAACCAGCAAGTCATGCTC
GACCTGATACGCGAGGACGGCATGGGCGAGGAAGACGAATGGTGGTACGGGCGCAACATCCCCGACTCGATCCGC
CCGACGAGGGGGGCCGCCGACGACGAGGCCGACTGCAGTTAG
Transcript >Ophun1|4656
ATGGCCCAGCAACGTCCGCTCGTCGCCATGGACCCTCCTCACATTACCGAATTCGCCTCGGAGCGCTACTTCGAA
AAGCTCCATCAGCTAAACGCCAGCCAGCCTCAGCAACAACCCGAGCCCTTCGCATCTCCCGCTCCGGCTTCTACC
ACTTTCTTTCTCCCGCTCCGCGAGGCCAGGCTGCCCGACCCCGACGCCTTCAAGCCCGCTGACCTGAAGCGTGAC
AAACCTCGCTTCTTCTCCCTACCTTTCAAGGATAGGCGCCCGTCTACAAAGCTGCCGACGAGTCCTCATCATGAG
TCTCCTCACGCATCGAACCCGAGGCTGTCAACCGACTCCGCTGCCAAGAGCCTTGCTTTGGGCCAGCTCTTCATG
TCTTTGCCCAACGAGCTGCAGATTCAGATCGTTTCGTCGCTCCCCTTGACAGACGTCCTCAACCTGCGGCTTCTC
TCCAAGTCGTGGCATGCTCTCGTCACACTCAACGAGTCCCCCATTGTTCGATACCATCTCGATCACCACATTCCC
GCCTACGCCCTCCGCCTCTACCCCTTATCGGTGCCCAGCGACGGCACCTTTCACCACCTCTGCAGCCTGTGGCAC
CGTCTTCATGTCGCCGCCAAGCTGGCCTTTCTCATGTGCGAATGGATCACCAAGGAGATCTTTTTGCGACACACC
GAGTTTCAACGCGCTGCGTTCGCGCCCCAGCACGAGCGCATGCGCCGTCGCCTCATCCCCCTTCTCTTCACCATC
TTTCACTTCTTCGAGACCCATCGAGCTCTTCACCTGAAACGCATCGCCGAATTCGACGGTCTCGCCCTCCGGAGG
GAGCCCTACACCGTCAATCCCATTGAGCGACAGATCTTTGACATGTACGACGACCAGACCCTGTTGAGGGTCCAC
GAGGTCTTCCCCCTCGTCATCTCATCCTTCTGCCGCCGCTTGCGACCGCCCACCTACGTCGGACGGGTAGAGCGA
TCCCTCCGCGGCTATCTCCGGGAGCGGCCCACCGACGAGGTCCACGCCGCCGTCCTTTGCATCGGGGGCCTCCGC
CAGGTCGAGAGGCTGTGGGAGATCAAGGGCTACAACAGCCGTCGAGCCTCCGTCGACGCCTGGTATCAAGCCCTG
TCCAAGGATCATGCCGTCGAGTCGTGCACCGCCAAGCTGCGCCTCGGCTTGAAGGGTTTCGGACGCAAGAGGCCC
GCCGCCTCCGCCCGGCCGTCGTCACGCGAGGGCTGGCCGAACACGAACAGAGCAAAGACATCGTCGGACCTGTCG
GACCCGACCCACGCCGAGGCCTCGTCCGAGTCCAACTGGGTCTTCTGCACCAGTCTGGCGGCCGACATGCCCATG
GCGCTCCCGTCCAAGGAGCACGCCCAGCTCATCCTCGACGACCTGCCCGGCCTCAAGCACATCTGGATGGTCACG
GCGGAGGCCACCATCCTGCAACGCGGCATAGTCCCCCGCACGCAGGACATTAAGCGGAACCAGCAAGTCATGCTC
GACCTGATACGCGAGGACGGCATGGGCGAGGAAGACGAATGGTGGTACGGGCGCAACATCCCCGACTCGATCCGC
CCGACGAGGGGGGCCGCCGACGACGAGGCCGACTGCAGTTAG
Gene >Ophun1|4656
ATGGCCCAGCAACGTCCGCTCGTCGCCATGGACCCTCCTCACATTACCGAATTCGCCTCGGAGCGCTACTTCGAA
AAGCTCCATCAGCTAAACGCCAGCCAGCCTCAGCAACAACCCGAGCCCTTCGCATCTCCCGCTCCGGCTTCTACC
ACTTTCTTTCTCCCGCTCCGCGAGGCCAGGCTGCCCGACCCCGACGCCTTCAAGCCCGCTGACCTGAAGCGTGAC
AAACCTCGCTTCTTCTCCCTACCTTTCAAGGATAGGCGCCCGTCTACAAAGCTGCCGACGAGTCCTCATCATGAG
TCTCCTCACGCATCGAACCCGAGGCTGTCAACCGACTCCGCTGCCAAGAGGTTTGCCTTCCCTTGACCCTTCTGG
AGTTCTTCACCTGTCTGACCCAGACCAGCCTTGCTTTGGGCCAGCTCTTCATGTCTTTGCCCAACGAGCTGCAGA
TTCAGATCGTTTCGTCGCTCCCCTTGACAGACGTCCTCAACCTGCGGCTTCTCTCCAAGTCGTGGCATGCTCTCG
TCACACTCAACGAGTCCCCCATTGTTCGATACCATCTCGATCACCACATTCCCGCCTACGCCCTCCGCCTCTACC
CCTTATCGGTGCCCAGCGACGGCACCTTTCACCACCTCTGCAGCCTGTGGCACCGTCTTCATGTCGCCGCCAAGC
TGGCCTTTCTCATGTGCGAATGGATCACCAAGGAGATCTTTTTGCGACACACCGAGTTTCAACGCGCTGCGTTCG
CGCCCCAGCACGAGCGCATGCGCCGTCGCCTCATCCCCCTTCTCTTCACCATCTTTCACTTCTTCGAGACCCATC
GAGCTCTTCACCTGAAACGCATCGCCGAATTCGACGGTCTCGCCCTCCGGAGGGAGCCCTACACCGTCAATCCCA
TTGAGCGACAGATCTTTGACATGTACGACGACCAGACCCTGTTGAGGGTCCACGAGGTCTTCCCCCTCGTCATCT
CATCCTTCTGCCGCCGCTTGCGACCGCCCACCTACGTCGGACGGGTAGAGCGATCCCTCCGCGGCTATCTCCGGG
AGCGGCCCACCGACGAGGTCCACGCCGCCGTCCTTTGCATCGGGGGCCTCCGCCAGGTCGAGAGGCTGTGGGAGA
TCAAGGGCTACAACAGCCGTCGAGCCTCCGTCGACGCCTGGTATCAAGCCCTGTCCAAGGATCATGCCGTCGAGT
CGTGCACCGCCAAGCTGCGCCTCGGCTTGAAGGGTTTCGGACGCAAGAGGCCCGCCGCCTCCGCCCGGCCGTCGT
CACGCGAGGGCTGGCCGAACACGAACAGAGCAAAGACATCGTCGGACCTGTCGGACCCGACCCACGCCGAGGCCT
CGTCCGAGTCCAACTGGGTCTTCTGCACCAGTCTGGCGGCCGACATGCCCATGGCGCTCCCGTCCAAGGAGCACG
CCCAGCTCATCCTCGACGACCTGCCCGGCCTCAAGCACATCTGGATGGTCACGGCGGAGGCCACCATCCTGCAAC
GCGGCATAGTCCCCCGCACGCAGGACATTAAGCGGAACCAGCAAGTCATGCTCGACCTGATACGCGAGGACGGCA
TGGGCGAGGAAGACGAATGGTGGTACGGGCGCAACATCCCCGACTCGATCCGCCCGACGAGGGGGGCCGCCGACG
ACGAGGCCGACTGCAGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail