Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4642
Gene name
LocationContig_432:11241..12497
Strand-
Gene length (bp)1256
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17832 Pre-PUA Pre-PUA-like domain 2.6E-18 86 164
PF01472 PUA PUA domain 7.1E-12 168 254
PF11720 Inhibitor_I78 Peptidase inhibitor I78 family 1.3E-07 22 78

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P89886|TMA20_YEAST Translation machinery-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA20 PE=1 SV=1 87 270 5.0E-49
sp|Q75AA8|TMA20_ASHGO Translation machinery-associated protein 20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TMA20 PE=3 SV=1 87 270 7.0E-46
sp|P87313|TMA20_SCHPO Translation machinery-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tma20 PE=3 SV=5 79 266 2.0E-39
sp|Q9W445|MCTS1_DROME Malignant T-cell-amplified sequence 1 homolog OS=Drosophila melanogaster GN=MCTS1 PE=1 SV=1 88 267 3.0E-33
sp|Q9DB27|MCTS1_MOUSE Malignant T-cell-amplified sequence 1 OS=Mus musculus GN=Mcts1 PE=1 SV=1 89 268 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P89886|TMA20_YEAST Translation machinery-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA20 PE=1 SV=1 87 270 5.0E-49
sp|Q75AA8|TMA20_ASHGO Translation machinery-associated protein 20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TMA20 PE=3 SV=1 87 270 7.0E-46
sp|P87313|TMA20_SCHPO Translation machinery-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tma20 PE=3 SV=5 79 266 2.0E-39
sp|Q9W445|MCTS1_DROME Malignant T-cell-amplified sequence 1 homolog OS=Drosophila melanogaster GN=MCTS1 PE=1 SV=1 88 267 3.0E-33
sp|Q9DB27|MCTS1_MOUSE Malignant T-cell-amplified sequence 1 OS=Mus musculus GN=Mcts1 PE=1 SV=1 89 268 1.0E-31
sp|Q9CQ21|MCTS2_MOUSE Malignant T-cell-amplified sequence 2 OS=Mus musculus GN=Mcts2 PE=1 SV=1 89 268 1.0E-31
sp|Q9ULC4|MCTS1_HUMAN Malignant T-cell-amplified sequence 1 OS=Homo sapiens GN=MCTS1 PE=1 SV=1 89 268 1.0E-31
sp|Q2KIE4|MCTS1_BOVIN Malignant T-cell-amplified sequence 1 OS=Bos taurus GN=MCTS1 PE=2 SV=1 89 268 1.0E-31
sp|Q4G009|MCTS1_RAT Malignant T-cell-amplified sequence 1 OS=Rattus norvegicus GN=Mcts1 PE=2 SV=1 89 268 1.0E-31
sp|Q6DER1|MCTS1_XENTR Malignant T-cell-amplified sequence 1 OS=Xenopus tropicalis GN=mcts1 PE=2 SV=1 89 268 2.0E-31
sp|Q6NRJ7|MCS1B_XENLA Malignant T-cell-amplified sequence 1-B OS=Xenopus laevis GN=mcts1-b PE=2 SV=1 89 268 4.0E-31
sp|Q5ZI42|MCTS1_CHICK Malignant T-cell-amplified sequence 1 OS=Gallus gallus GN=MCTS1 PE=2 SV=1 89 268 6.0E-31
sp|Q5PPY1|MCS1A_XENLA Malignant T-cell-amplified sequence 1-A OS=Xenopus laevis GN=mcts1-a PE=2 SV=1 89 268 2.0E-30
sp|Q86KL4|MCTS1_DICDI Malignant T-cell-amplified sequence 1 homolog OS=Dictyostelium discoideum GN=mcts1 PE=3 SV=1 88 266 4.0E-30
sp|Q7ZV34|MCTS1_DANRE Malignant T-cell-amplified sequence 1 OS=Danio rerio GN=mcts1 PE=2 SV=1 89 268 2.0E-29
sp|Q58827|Y1432_METJA Uncharacterized protein MJ1432 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1432 PE=3 SV=1 113 268 7.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup349
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2944
Ophiocordyceps australis map64 (Brazil) OphauB2|3435
Ophiocordyceps australis map64 (Brazil) OphauB2|3436
Ophiocordyceps camponoti-floridani Ophcf2|04676
Ophiocordyceps camponoti-floridani Ophcf2|04677
Ophiocordyceps camponoti-rufipedis Ophun1|4642 (this protein)
Ophiocordyceps kimflemingae Ophio5|5646
Ophiocordyceps kimflemingae Ophio5|5647
Ophiocordyceps subramaniannii Hirsu2|5440

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4642
MPLVVPGLTSAAANSTEEWQNKLVGKKLSETETNETAFCKKDLPKEHRIISPGTMVTKDHNENRLNVHLDEEGVV
SHVLHGITPGPKQKLKSSVQRTLRQSLQTTYPLLTPYMDEVLPKKASLESMKLPDRNTLYVLDNEPLFFRQDSEP
PALLPHLRLVHRFPAAFPTVRIDRGAIRFVLSGATLMAPGLTSAGGRLPVGGGEDGEDGDGRWGRELGKGEGVVV
MAEGKTEACAVGVLVCGTEEVKAKGKGPVMEDAHFLGDGLWNLGMG*
Coding >Ophun1|4642
ATGCCGCTTGTTGTCCCTGGACTCACTTCGGCTGCGGCCAACTCGACGGAAGAATGGCAGAACAAACTCGTCGGC
AAGAAGCTCTCGGAAACGGAGACGAACGAGACGGCGTTTTGCAAAAAGGATCTTCCCAAGGAGCATCGCATCATA
TCGCCCGGCACCATGGTCACCAAGGATCACAACGAGAATAGGCTCAACGTCCATCTGGATGAGGAGGGCGTCGTG
TCGCACGTGCTGCATGGAATCACCCCCGGCCCCAAGCAAAAGCTCAAGTCGTCGGTGCAGCGAACCCTCCGCCAA
TCGCTGCAGACGACTTACCCCCTCCTCACCCCCTACATGGACGAGGTGCTGCCCAAGAAGGCCTCGCTGGAGAGC
ATGAAGCTTCCAGACCGCAACACGCTGTACGTCCTCGACAACGAGCCCCTCTTCTTCCGACAGGATTCCGAACCG
CCCGCCCTGCTGCCTCACCTGCGGCTCGTGCACCGCTTCCCCGCCGCGTTCCCGACGGTGCGCATCGACCGCGGC
GCTATCCGCTTCGTGCTGTCGGGCGCGACGCTCATGGCGCCTGGGTTGACGTCTGCGGGCGGGAGGTTGCCTGTT
GGTGGTGGCGAGGATGGCGAGGATGGCGATGGGCGGTGGGGGAGGGAGCTGGGCAAGGGGGAGGGGGTTGTCGTC
ATGGCGGAGGGGAAGACGGAGGCTTGTGCCGTTGGCGTCTTGGTTTGCGGGACGGAAGAGGTTAAGGCGAAGGGC
AAGGGGCCTGTTATGGAGGATGCGCACTTTTTGGGCGATGGGCTTTGGAACTTGGGAATGGGATGA
Transcript >Ophun1|4642
ATGCCGCTTGTTGTCCCTGGACTCACTTCGGCTGCGGCCAACTCGACGGAAGAATGGCAGAACAAACTCGTCGGC
AAGAAGCTCTCGGAAACGGAGACGAACGAGACGGCGTTTTGCAAAAAGGATCTTCCCAAGGAGCATCGCATCATA
TCGCCCGGCACCATGGTCACCAAGGATCACAACGAGAATAGGCTCAACGTCCATCTGGATGAGGAGGGCGTCGTG
TCGCACGTGCTGCATGGAATCACCCCCGGCCCCAAGCAAAAGCTCAAGTCGTCGGTGCAGCGAACCCTCCGCCAA
TCGCTGCAGACGACTTACCCCCTCCTCACCCCCTACATGGACGAGGTGCTGCCCAAGAAGGCCTCGCTGGAGAGC
ATGAAGCTTCCAGACCGCAACACGCTGTACGTCCTCGACAACGAGCCCCTCTTCTTCCGACAGGATTCCGAACCG
CCCGCCCTGCTGCCTCACCTGCGGCTCGTGCACCGCTTCCCCGCCGCGTTCCCGACGGTGCGCATCGACCGCGGC
GCTATCCGCTTCGTGCTGTCGGGCGCGACGCTCATGGCGCCTGGGTTGACGTCTGCGGGCGGGAGGTTGCCTGTT
GGTGGTGGCGAGGATGGCGAGGATGGCGATGGGCGGTGGGGGAGGGAGCTGGGCAAGGGGGAGGGGGTTGTCGTC
ATGGCGGAGGGGAAGACGGAGGCTTGTGCCGTTGGCGTCTTGGTTTGCGGGACGGAAGAGGTTAAGGCGAAGGGC
AAGGGGCCTGTTATGGAGGATGCGCACTTTTTGGGCGATGGGCTTTGGAACTTGGGAATGGGATGA
Gene >Ophun1|4642
ATGCCGCTTGTTGTCCCTGGACTCACTTCGGCTGCGGCCAACTCGACGGAAGAATGGCAGAACAAACTCGTCGGC
AAGAAGCTCTCGGAAACGGAGACGAACGAGACGGTACGTCGGGGTGCGATGAAGCGAGAGGCCTAGAGGCTGACT
AGGAGATGGTAAGGCGTTTTGCAAAAAGGATCTTCCCAAGGAGCATCGCATCATATCGCCCGGCACCATGGTCAC
CAAGGATCACAACGAGAATAGGCTCAACGTCCATCTGGATGAGGAGGGCGTCGTGTCGCACGTGCTGCATGGGTA
GGCGAGAGAGGTGAAGGGTGGCTATGAATTAGGATGGAGGAGGATACGATGGAGGATCCTGTGATTCGGGTCTAT
GGCATGCTGTTGAGAGGTGAGGCTGGGACTCTCCATGCGATTTGCTGTATTTGTGCTTGTCTGCTCGGTTGATTT
GGTGAGGCGGTGCGGGTTGGGCCGGCTGTTGAGACGGTACATGTGGGGGATTCGGAGGGTGGGCGGCGGAGAGGG
TACCGCGCTAGCAATAAACGACGTATCCACCCCCGCCACAGCTCTCTCCGGGGAAAACTCGACAAGCCAAAGTCC
ATGCACCCATCACCATGTTCAAGAAGGAGTCAGTCTCCCCCTTGGAACAGGAAAAGACCTCTCGCTAACAAGCGC
TACACAGAATCACCCCCGGCCCCAAGCAAAAGCTCAAGTCGTCGGTGCAGCGAACCCTCCGCCAATCGCTGCAGA
CGACTTACCCCCTCCTCACCCCCTACATGGACGAGGTGCTGCCCAAGAAGGCCTCGCTGGAGAGCATGAAGCTTC
CAGACCGCAACACGCTGTACGTCCTCGACAACGAGCCCCTCTTCTTCCGACAGGATTCCGAACCGCCCGCCCTGC
TGCCTCACCTGCGGCTCGTGCACCGCTTCCCCGCCGCGTTCCCGACGGTGCGCATCGACCGCGGCGCTATCCGCT
TCGTGCTGTCGGGCGCGACGCTCATGGCGCCTGGGTTGACGTCTGCGGGCGGGAGGTTGCCTGTTGGTGGTGGCG
AGGATGGCGAGGATGGCGATGGGCGGTGGGGGAGGGAGCTGGGCAAGGGGGAGGGGGTTGTCGTCATGGCGGAGG
GGAAGACGGAGGCTTGTGCCGTTGGCGTCTTGGTTTGCGGGACGGAAGAGGTTAAGGCGAAGGGCAAGGGGCCTG
TTATGGAGGATGCGCACTTTTTGGGCGATGGGCTTTGGAACTTGGGAATGGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail