Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4638
Gene name
LocationContig_432:4731..5816
Strand+
Gene length (bp)1085
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 1.1E-42 22 221
PF08237 PE-PPE PE-PPE domain 8.9E-05 64 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 24 221 3.0E-19
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 24 252 2.0E-16
sp|P9WP39|CUT3_MYCTU Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut3 PE=1 SV=1 26 221 6.0E-07
sp|P0A537|CUT3_MYCBO Probable cutinase cut3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut3 PE=3 SV=1 26 221 6.0E-07
sp|P9WP38|CUT3_MYCTO Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut3 PE=3 SV=1 26 221 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 24 221 3.0E-19
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 24 252 2.0E-16
sp|P9WP39|CUT3_MYCTU Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut3 PE=1 SV=1 26 221 6.0E-07
sp|P0A537|CUT3_MYCBO Probable cutinase cut3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut3 PE=3 SV=1 26 221 6.0E-07
sp|P9WP38|CUT3_MYCTO Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut3 PE=3 SV=1 26 221 7.0E-07
sp|P9WP41|CUT2_MYCTU Probable cutinase cut2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut2 PE=1 SV=1 26 201 7.0E-06
sp|P9WP40|CUT2_MYCTO Probable cutinase cut2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut2 PE=3 SV=1 26 201 7.0E-06
sp|P63882|CUT2_MYCBO Probable cutinase cut2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut2 PE=3 SV=1 26 201 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999585

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
CE5 7.5E-41 24 221

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3423
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7391
Ophiocordyceps australis map64 (Brazil) OphauB2|3425
Ophiocordyceps camponoti-floridani Ophcf2|04681
Ophiocordyceps camponoti-rufipedis Ophun1|4638 (this protein)
Ophiocordyceps kimflemingae Ophio5|5191
Ophiocordyceps subramaniannii Hirsu2|646

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4638
MRSSALALAALVAGTAAESCRSGLYIIVARGTSEVQGSGIMGSVADGIAKEVAGSQVAPLQYPASLSDPVYQDSV
AAGVRQMQKTLRNHVKNCPRSKLAILGYSQGAQVAMDALCGSVGVEGFENSTAIDSSLIKDHIVAVALFGDPSHV
ANVTYDRGTSIRNGIFNRTSSSVQECKAFSDRIVSYCDVGDIYCDVGDVKTVHGLYVSRYGAEVQHFVVDRYNKD
AAMTRNATEPSSTAPSSSTASPSGTATSSSTASPSSAANGGAGRAGDRTSGGARAEGGVGLAALSVGLLVALAMG
*
Coding >Ophun1|4638
ATGCGCTCAAGCGCCCTCGCCCTGGCCGCTCTGGTCGCCGGCACTGCAGCCGAGTCGTGCCGATCCGGCCTCTAC
ATCATCGTCGCCCGCGGCACCAGCGAAGTCCAAGGCTCCGGCATCATGGGCAGCGTAGCTGACGGCATCGCCAAG
GAGGTTGCCGGCTCTCAGGTCGCACCTCTGCAGTACCCGGCCAGCCTATCGGACCCCGTCTACCAGGACTCCGTC
GCTGCAGGCGTTCGGCAGATGCAGAAGACGTTGAGGAATCATGTCAAGAACTGTCCGCGTTCCAAGTTGGCCATT
TTGGGCTACTCGCAGGGCGCTCAAGTGGCTATGGATGCCCTCTGCGGCTCCGTGGGCGTCGAAGGCTTTGAGAAC
TCGACGGCCATCGATAGCAGCTTGATTAAGGATCACATCGTGGCCGTCGCCTTGTTCGGCGATCCATCCCACGTT
GCCAACGTCACGTACGACAGGGGAACTAGCATCCGGAACGGGATCTTCAACCGCACTAGCAGCTCGGTGCAGGAG
TGCAAGGCCTTTTCCGACCGCATCGTCTCATACTGCGACGTGGGGGATATTTACTGCGATGTGGGGGACGTCAAG
ACGGTGCACGGCCTCTATGTATCCCGCTACGGCGCCGAGGTGCAGCATTTCGTCGTCGACAGATACAACAAGGAT
GCAGCCATGACGCGAAACGCGACCGAACCCTCGAGTACGGCCCCGTCCTCGAGCACCGCTTCGCCTTCGGGCACG
GCCACGTCTTCCAGCACGGCCTCGCCGAGTTCAGCGGCCAATGGCGGAGCGGGCCGAGCCGGTGACAGGACCTCG
GGAGGGGCAAGGGCGGAAGGCGGAGTTGGTCTCGCGGCCCTGTCTGTGGGGTTGCTGGTGGCTTTGGCGATGGGA
TGA
Transcript >Ophun1|4638
ATGCGCTCAAGCGCCCTCGCCCTGGCCGCTCTGGTCGCCGGCACTGCAGCCGAGTCGTGCCGATCCGGCCTCTAC
ATCATCGTCGCCCGCGGCACCAGCGAAGTCCAAGGCTCCGGCATCATGGGCAGCGTAGCTGACGGCATCGCCAAG
GAGGTTGCCGGCTCTCAGGTCGCACCTCTGCAGTACCCGGCCAGCCTATCGGACCCCGTCTACCAGGACTCCGTC
GCTGCAGGCGTTCGGCAGATGCAGAAGACGTTGAGGAATCATGTCAAGAACTGTCCGCGTTCCAAGTTGGCCATT
TTGGGCTACTCGCAGGGCGCTCAAGTGGCTATGGATGCCCTCTGCGGCTCCGTGGGCGTCGAAGGCTTTGAGAAC
TCGACGGCCATCGATAGCAGCTTGATTAAGGATCACATCGTGGCCGTCGCCTTGTTCGGCGATCCATCCCACGTT
GCCAACGTCACGTACGACAGGGGAACTAGCATCCGGAACGGGATCTTCAACCGCACTAGCAGCTCGGTGCAGGAG
TGCAAGGCCTTTTCCGACCGCATCGTCTCATACTGCGACGTGGGGGATATTTACTGCGATGTGGGGGACGTCAAG
ACGGTGCACGGCCTCTATGTATCCCGCTACGGCGCCGAGGTGCAGCATTTCGTCGTCGACAGATACAACAAGGAT
GCAGCCATGACGCGAAACGCGACCGAACCCTCGAGTACGGCCCCGTCCTCGAGCACCGCTTCGCCTTCGGGCACG
GCCACGTCTTCCAGCACGGCCTCGCCGAGTTCAGCGGCCAATGGCGGAGCGGGCCGAGCCGGTGACAGGACCTCG
GGAGGGGCAAGGGCGGAAGGCGGAGTTGGTCTCGCGGCCCTGTCTGTGGGGTTGCTGGTGGCTTTGGCGATGGGA
TGA
Gene >Ophun1|4638
ATGCGCTCAAGCGCCCTCGCCCTGGCCGCTCTGGTCGCCGGCACTGCAGCCGAGTCGTGCCGATCCGGCCTCTAC
ATCATCGTCGCCCGCGGCACCAGCGAAGTCCAAGGCTCCGGCATCATGGGCAGCGTAGCTGACGGCATCGCCAAG
GAGGTTGCCGGCTCTCAGGTCGCACCTCTGCAGTACCCGGCCAGCCTATCGGACCCCGTCTACCAGGACTCCGTC
GCTGCAGGCGTTCGGCAGATGCAGAAGACGTTGAGGAATCATGTCAAGAACTGTCCGCGTTCCAAGTTGGCCATT
TTGGGCTACTCGCAGGTATCGGACCCCTGTCTCTCGTCCGTCTTACGAATAGTCGTGTCTGAATTGATGGCGTCC
AGGGCGCTCAAGTGGCTATGGATGCCCTCTGCGGCTCCGTGGGCGTCGAAGGCTTTGAGAACTCGACGGCCATCG
ATAGCAGCTTGATTAAGGATCACAGTTGGTGTCTCAACCCCATTTCTCCAGCTCGGCTTCTCTGACCCTCCTTGT
CGCCAGTCGTGGCCGTCGCCTTGTTCGGCGATCCATCCCACGTTGCCAACGTCACGTACGACAGGGGAACTAGCA
TCCGGAACGGGGTACGTTAGCGGATCGGAAATCAAGTGGCTCGAGACAAACGTGTGAGACTGACTGATCGGCAGA
TCTTCAACCGCACTAGCAGCTCGGTGCAGGAGTGCAAGGCCTTTTCCGACCGCATCGTCTCATACTGCGACGTGG
GGGATATTTACTGCGATGTGGGGGACGTCAAGACGGTGCACGGCCTCTATGTATCCCGCTACGGCGCCGAGGTGC
AGCATTTCGTCGTCGACAGATACAACAAGGATGCAGCCATGACGCGAAACGCGACCGAACCCTCGAGTACGGCCC
CGTCCTCGAGCACCGCTTCGCCTTCGGGCACGGCCACGTCTTCCAGCACGGCCTCGCCGAGTTCAGCGGCCAATG
GCGGAGCGGGCCGAGCCGGTGACAGGACCTCGGGAGGGGCAAGGGCGGAAGGCGGAGTTGGTCTCGCGGCCCTGT
CTGTGGGGTTGCTGGTGGCTTTGGCGATGGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail