Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4637
Gene name
LocationContig_432:1347..3056
Strand-
Gene length (bp)1709
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.6E-35 73 476

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 38 522 5.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 101 530 1.0E-52
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 55 520 4.0E-37
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 56 522 5.0E-35
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 91 473 9.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 38 522 5.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 101 530 1.0E-52
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 55 520 4.0E-37
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 56 522 5.0E-35
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 91 473 9.0E-20
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 91 473 9.0E-20
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 87 384 8.0E-18
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 122 487 8.0E-17
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 90 406 5.0E-16
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 90 406 5.0E-16
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 87 373 5.0E-16
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 87 373 5.0E-16
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 87 485 6.0E-16
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 105 369 3.0E-13
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 67 473 5.0E-13
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 21 399 5.0E-13
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 90 322 1.0E-12
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 126 402 3.0E-12
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 68 225 4.0E-12
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 102 390 4.0E-12
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 126 402 4.0E-12
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 91 370 7.0E-12
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 86 524 2.0E-11
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 30 357 2.0E-11
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 86 524 2.0E-11
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 90 403 3.0E-11
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 90 403 3.0E-11
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 102 363 5.0E-11
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 112 481 8.0E-10
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 87 223 3.0E-09
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 87 223 3.0E-09
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 87 223 3.0E-09
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 87 223 4.0E-09
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 87 223 4.0E-09
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 124 385 1.0E-08
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 124 385 1.0E-08
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 82 346 1.0E-08
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 87 388 3.0E-08
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 87 326 4.0E-08
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 87 223 4.0E-08
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 90 412 8.0E-08
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 87 372 3.0E-07
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 87 388 3.0E-07
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 90 359 6.0E-07
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 86 225 8.0E-07
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 106 251 1.0E-06
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 106 251 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 134 153 19
3 158 180 22
4 193 215 22
5 219 241 22
6 254 276 22
7 289 311 22
8 331 353 22
9 363 385 22
10 392 411 19
11 421 443 22
12 464 486 22
13 501 523 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4637
MKVTSLLQRLGTGEAVEKPENVRPLSTSHVNPSSSGDDSDGGALVTDVKLLGRLRPPVFSGPLAEAGFIFTVVLS
MMTSEYFVGGFNLILPSIAEALHMPPATRTWPAGVVTLTTASLLQPFSRLCDMYGSRRVFLYGQAWLLAWSVVTG
FSVNTAMLIVCRAMQGIGAAAFLPAGLALLGHTYRPGPRKNVAFSIYGAFACVGFYFGIFLGALAAEFITWRWYF
WFGAVACLITLALGLLTIPRDLSDVDPDAAMDWLGVCTIVPGLVLVVFAFTDAGDAFGGWRNPYIFVTLIIGVLF
LAAAVYVQGWVSAQPLLPPALFKPKYMKRLMLSLFCYYGVFGIFLLYTSFYIENILGVKPLLAAAWYTPLAVGGM
FLAIGGGLVLHIIPNRILLIISGFGFFISVLLFALIPGPDDGKSLSFIYWAYVFSAMLGGTLGIDVTFNVTNVFI
TTAMPRRLQAAASGVINSLLYLGVAFWLGVAQTAISTADERQEGGIKPEAQYRIAFWTGVVLAAVGLLLTASIKI
GQASAGLTADERLAMEDEARSVSG*
Coding >Ophun1|4637
ATGAAGGTCACCTCGCTCCTCCAGCGACTCGGGACTGGTGAGGCAGTCGAGAAGCCTGAAAATGTGCGCCCTCTG
TCGACAAGCCATGTCAACCCGTCGTCATCGGGTGACGACAGCGACGGTGGCGCACTCGTCACCGACGTCAAGCTT
CTCGGCCGGCTTCGCCCCCCCGTCTTCTCCGGTCCCCTCGCCGAGGCCGGCTTCATCTTCACCGTCGTTCTCTCC
ATGATGACGAGCGAGTACTTCGTCGGCGGCTTCAACCTCATCCTTCCCTCCATCGCCGAGGCCCTCCACATGCCA
CCAGCAACCCGCACCTGGCCCGCCGGTGTGGTGACTCTGACGACGGCATCGCTGCTACAGCCCTTTTCCCGCCTC
TGCGACATGTACGGCAGCCGGCGTGTCTTTCTCTATGGCCAGGCCTGGCTGCTAGCCTGGTCCGTCGTCACCGGC
TTCAGCGTCAACACCGCCATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCTGCTGCCTTTCTACCGGCC
GGTCTCGCCCTACTGGGCCACACGTACCGGCCTGGCCCACGCAAGAACGTGGCCTTTTCCATCTACGGCGCCTTC
GCCTGCGTCGGCTTCTACTTTGGCATCTTCCTCGGCGCCCTGGCGGCAGAGTTCATCACCTGGAGATGGTACTTT
TGGTTCGGCGCCGTCGCCTGTCTCATCACCCTGGCCTTGGGCCTACTTACGATCCCTCGGGACCTCTCGGACGTG
GATCCGGACGCGGCCATGGACTGGTTAGGCGTCTGCACCATCGTCCCGGGCCTCGTCCTCGTTGTCTTTGCCTTT
ACCGACGCCGGCGACGCCTTTGGAGGCTGGCGCAACCCATACATCTTCGTGACGCTCATTATCGGAGTCTTATTC
CTCGCCGCCGCCGTCTACGTCCAGGGCTGGGTCTCGGCTCAGCCGTTGCTGCCGCCGGCCCTCTTCAAGCCCAAA
TACATGAAGCGGCTCATGCTGTCGCTGTTTTGCTACTACGGCGTCTTTGGAATCTTTCTTTTGTACACGAGTTTC
TACATCGAAAACATTCTCGGCGTCAAGCCTCTCCTGGCTGCAGCCTGGTACACTCCTCTCGCCGTCGGCGGCATG
TTCCTCGCCATCGGCGGCGGCCTCGTCCTACACATCATCCCCAACCGCATCCTCCTCATCATCTCCGGCTTCGGC
TTCTTCATTTCCGTCCTCCTCTTCGCCCTCATCCCCGGCCCCGATGACGGCAAGTCCCTCAGCTTCATCTACTGG
GCCTACGTCTTCTCCGCTATGCTGGGCGGCACCCTCGGCATCGACGTCACCTTTAACGTCACAAACGTCTTCATC
ACTACCGCCATGCCCCGTCGGTTGCAGGCAGCCGCCAGCGGCGTCATCAACAGTCTGTTATATCTGGGCGTCGCC
TTCTGGCTCGGCGTCGCACAGACAGCCATCTCGACCGCGGACGAGAGGCAAGAGGGGGGTATCAAGCCCGAGGCT
CAGTACCGCATTGCTTTTTGGACGGGCGTCGTGCTTGCGGCTGTAGGGCTGCTGCTGACGGCCAGCATAAAGATT
GGACAGGCGTCAGCTGGTCTGACGGCTGACGAGAGGCTAGCGATGGAGGATGAGGCGAGAAGCGTGAGTGGTTGA
Transcript >Ophun1|4637
ATGAAGGTCACCTCGCTCCTCCAGCGACTCGGGACTGGTGAGGCAGTCGAGAAGCCTGAAAATGTGCGCCCTCTG
TCGACAAGCCATGTCAACCCGTCGTCATCGGGTGACGACAGCGACGGTGGCGCACTCGTCACCGACGTCAAGCTT
CTCGGCCGGCTTCGCCCCCCCGTCTTCTCCGGTCCCCTCGCCGAGGCCGGCTTCATCTTCACCGTCGTTCTCTCC
ATGATGACGAGCGAGTACTTCGTCGGCGGCTTCAACCTCATCCTTCCCTCCATCGCCGAGGCCCTCCACATGCCA
CCAGCAACCCGCACCTGGCCCGCCGGTGTGGTGACTCTGACGACGGCATCGCTGCTACAGCCCTTTTCCCGCCTC
TGCGACATGTACGGCAGCCGGCGTGTCTTTCTCTATGGCCAGGCCTGGCTGCTAGCCTGGTCCGTCGTCACCGGC
TTCAGCGTCAACACCGCCATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCTGCTGCCTTTCTACCGGCC
GGTCTCGCCCTACTGGGCCACACGTACCGGCCTGGCCCACGCAAGAACGTGGCCTTTTCCATCTACGGCGCCTTC
GCCTGCGTCGGCTTCTACTTTGGCATCTTCCTCGGCGCCCTGGCGGCAGAGTTCATCACCTGGAGATGGTACTTT
TGGTTCGGCGCCGTCGCCTGTCTCATCACCCTGGCCTTGGGCCTACTTACGATCCCTCGGGACCTCTCGGACGTG
GATCCGGACGCGGCCATGGACTGGTTAGGCGTCTGCACCATCGTCCCGGGCCTCGTCCTCGTTGTCTTTGCCTTT
ACCGACGCCGGCGACGCCTTTGGAGGCTGGCGCAACCCATACATCTTCGTGACGCTCATTATCGGAGTCTTATTC
CTCGCCGCCGCCGTCTACGTCCAGGGCTGGGTCTCGGCTCAGCCGTTGCTGCCGCCGGCCCTCTTCAAGCCCAAA
TACATGAAGCGGCTCATGCTGTCGCTGTTTTGCTACTACGGCGTCTTTGGAATCTTTCTTTTGTACACGAGTTTC
TACATCGAAAACATTCTCGGCGTCAAGCCTCTCCTGGCTGCAGCCTGGTACACTCCTCTCGCCGTCGGCGGCATG
TTCCTCGCCATCGGCGGCGGCCTCGTCCTACACATCATCCCCAACCGCATCCTCCTCATCATCTCCGGCTTCGGC
TTCTTCATTTCCGTCCTCCTCTTCGCCCTCATCCCCGGCCCCGATGACGGCAAGTCCCTCAGCTTCATCTACTGG
GCCTACGTCTTCTCCGCTATGCTGGGCGGCACCCTCGGCATCGACGTCACCTTTAACGTCACAAACGTCTTCATC
ACTACCGCCATGCCCCGTCGGTTGCAGGCAGCCGCCAGCGGCGTCATCAACAGTCTGTTATATCTGGGCGTCGCC
TTCTGGCTCGGCGTCGCACAGACAGCCATCTCGACCGCGGACGAGAGGCAAGAGGGGGGTATCAAGCCCGAGGCT
CAGTACCGCATTGCTTTTTGGACGGGCGTCGTGCTTGCGGCTGTAGGGCTGCTGCTGACGGCCAGCATAAAGATT
GGACAGGCGTCAGCTGGTCTGACGGCTGACGAGAGGCTAGCGATGGAGGATGAGGCGAGAAGCGTGAGTGGTTGA
Gene >Ophun1|4637
ATGAAGGTCACCTCGCTCCTCCAGCGACTCGGGACTGGTGAGGCAGTCGAGAAGCCTGAAAATGTGCGCCCTCTG
TCGACAAGCCATGTCAACCCGTCGTCATCGGGTGACGACAGCGACGGTGGCGCACTCGTCACCGACGTCAAGCTT
CTCGGCCGGCTTCGCCCCCCCGTCTTCTCCGGTCCCCTCGCCGAGGCCGGCTTCATCTTCACCGTCGTTCTCTCC
ATGATGACGAGCGAGTACTTCGTCGGCGGCTTCAACCTCATCCTTCCCTCCATCGCCGAGGCCCTCCACATGCCA
CCAGCAACCCGCACCTGGCCCGCCGGTGTGGTGACTCTGACGACGGCATCGCTGCTACAGCCCTTTTCCCGCCTC
TGCGACATGTACGGCAGCCGGCGTGTCTTTCTCTATGGCCAGGCCTGGCTGCTAGCCTGGTCCGTCGTCACCGGC
TTCAGCGTCAACACCGCCATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCTGCTGCCTTTCTACCGGCC
GGTCTCGCCCTACTGGGCCACACGTACCGGCCTGGCCCACGCAAGAACGTGGCCTTTTCCATCTACGGCGCCTTC
GCCTGCGTCGGCTTCTACTTTGGCATCTTCCTCGGCGCCCTGGCGGCAGAGTTCATCACCTGGAGATGGTACTTT
TGGTTCGGCGCCGTCGCCTGTCTCATCACCCTGGCCTTGGGCCTACTTACGATCCCTCGGGACCTCTCGGACGTG
GATCCGGACGCGGCCATGGACTGGTTAGGCGTCTGCACCATCGTCCCGGGCCTCGTCCTCGTTGTCTTTGCCTTT
ACCGACGCCGGCGACGCCTTTGGAGGCTGGCGCAACCCATACATCTTCGTGACGCTCATTATCGGAGTCTTATTC
CTCGCCGCCGCCGTCTACGTCCAGGGCTGGGTCTCGGCTCAGCCGTTGCTGCCGCCGGCCCTCTTCAAGCCCAAA
TACATGAAGCGGCTCATGCTGTCGCTGTTTTGCTACTACGGCGTCTTTGGAATCTTTCTTTTGTACACGAGTTTC
TAGTATGTCCAGTTCATCCCCTGAAGCTTTGCGAAGACGACGGCTAACAAATCGACAACAGCATCGAAAACATTC
TCGGCGTCAAGCCTCTCCTGGCTGCAGCCTGGTACACTCCTCTCGCCGTCGGCGGCATGTTCCTCGCCATCGGCG
GCGGCCTCGTCCTACACATCATCCCCAACCGCATCCTCCTCATCATCTCCGGCTTCGGCTTCTTCATTTCCGTCC
TCCTCTTCGCCCTCATCCCCGGCCCCGATGACGGCAAGTCCCTCAGCTTCATCTACTGGGCCTACGTCTTCTCCG
CTATGCTGGGCGGCACCCTCGGCATCGACGTCACCTTTAACGTCACAAACGTCTTCATCACTACCGCCATGCCCC
GTCGGTTGCAGGCAGCCGCCAGCGGCGTCATCAACAGTCTGTTATATCTGGGCGTCGCCTTCTGGCTCGGCGTCG
CACAGACAGCCATCTCGACCGCGGACGAGAGGCAAGAGGGGGGTATCAAGCCCGAGGCTCAGTACCGCATTGCTT
TTTGGACGGGCGTCGTGCTTGCGGCTGTAGGGCTGCTGCTGACGGCCAGCATAAAGATTGGACAGGCGTCAGCTG
GTCTGACGGCTGACGAGAGGCTAGCGATGGAGGATGAGGCGAGAAGCGTGAGTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail